bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_6 Length=58 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_C_029_Microviridae_AG0110_hypothetical.... 51.6 3e-12 Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.p... 42.4 7e-09 Alpavirinae_Human_feces_B_020_Microviridae_AG0354_hypothetical.... 37.0 6e-07 Microvirus_gi|242346750|ref|YP_002985212.1|_gpF_[Enterobacteria... 20.0 1.9 Gokush_68_Microbialite_003_Microviridae_AG0157_putative.VP4 19.6 2.7 Alpavirinae_Human_feces_A_016_Microviridae_AG005_hypothetical.p... 19.6 2.9 Gokush_Bourget_052_Microviridae_AG0193_putative.VP1 19.2 4.4 Alpavirinae_Human_feces_C_010_Microviridae_AG0197_hypothetical.... 18.5 8.7 Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 18.5 9.4 Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 18.5 9.4 > Alpavirinae_Human_feces_C_029_Microviridae_AG0110_hypothetical.protein Length=54 Score = 51.6 bits (122), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 0/49 (0%) Query 10 VKTSYELCEDVITKKYIIRKLERRLICEKIYDSEEEELKIWRQKQLKLW 58 V +E+ ED + K+Y + + ER+LICEK YD + E+LK W KQLKL+ Sbjct 6 VTQGFEIFEDTVIKEYNLNRKERKLICEKTYDKDLEDLKKWNHKQLKLF 54 > Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.protein Length=54 Score = 42.4 bits (98), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%) Query 12 TSYELCEDVITKKYIIRKLERRLICEKIYDSEEEELKIWRQKQLKLW 58 +E+ ED I K+Y + + ERRLI EK YD +++ L+ +QLKLW Sbjct 8 NGFEIFEDTIIKEYNLNRKERRLIIEKTYDEQKDLLRHVLNQQLKLW 54 > Alpavirinae_Human_feces_B_020_Microviridae_AG0354_hypothetical.protein Length=80 Score = 37.0 bits (84), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 19/58 (33%), Positives = 31/58 (53%), Gaps = 0/58 (0%) Query 1 VWYQTPQKSVKTSYELCEDVITKKYIIRKLERRLICEKIYDSEEEELKIWRQKQLKLW 58 +W+ +++ ED I K Y I+K ERRL+ E YD E+ + + + QL L+ Sbjct 17 LWHNLHTGETLEGFQIWEDTIFKSYNIKKTERRLLVEITYDLEKSQKEYFENLQLNLF 74 > Microvirus_gi|242346750|ref|YP_002985212.1|_gpF_[Enterobacteria_phage_St-1] Length=431 Score = 20.0 bits (40), Expect = 1.9, Method: Composition-based stats. Identities = 7/18 (39%), Positives = 10/18 (56%), Gaps = 0/18 (0%) Query 1 VWYQTPQKSVKTSYELCE 18 +WY+T V Y+L E Sbjct 350 IWYRTHPDYVNYKYQLLE 367 > Gokush_68_Microbialite_003_Microviridae_AG0157_putative.VP4 Length=337 Score = 19.6 bits (39), Expect = 2.7, Method: Compositional matrix adjust. Identities = 10/19 (53%), Positives = 14/19 (74%), Gaps = 1/19 (5%) Query 37 EKIYDSEEEELKIWRQKQL 55 EK+Y+S EE KIW++ L Sbjct 169 EKVYES-EELAKIWKKGNL 186 > Alpavirinae_Human_feces_A_016_Microviridae_AG005_hypothetical.protein Length=116 Score = 19.6 bits (39), Expect = 2.9, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 11/19 (58%), Gaps = 0/19 (0%) Query 5 TPQKSVKTSYELCEDVITK 23 P K T YE E+++TK Sbjct 11 NPFKEFPTKYEEGENILTK 29 > Gokush_Bourget_052_Microviridae_AG0193_putative.VP1 Length=528 Score = 19.2 bits (38), Expect = 4.4, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 16/24 (67%), Gaps = 7/24 (29%) Query 5 TPQKSVKTSYE-------LCEDVI 21 T QK++KT+++ +CE+V+ Sbjct 26 TMQKTLKTTFDAGYLVPIMCEEVL 49 > Alpavirinae_Human_feces_C_010_Microviridae_AG0197_hypothetical.protein.BACPLE Length=382 Score = 18.5 bits (36), Expect = 8.7, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (57%), Gaps = 2/30 (7%) Query 18 EDVITKKY--IIRKLERRLICEKIYDSEEE 45 E+++ K+ +R E L+C+K Y +E Sbjct 235 ENIVQLKFDRYLRSNEFELLCKKTYQDMKE 264 > Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 Length=536 Score = 18.5 bits (36), Expect = 9.4, Method: Composition-based stats. Identities = 7/22 (32%), Positives = 15/22 (68%), Gaps = 7/22 (32%) Query 7 QKSVKTSYE-------LCEDVI 21 QK++KT+++ +CE+V+ Sbjct 28 QKTLKTTFDSGYIVPIMCEEVL 49 > Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 Length=536 Score = 18.5 bits (36), Expect = 9.4, Method: Composition-based stats. Identities = 7/22 (32%), Positives = 15/22 (68%), Gaps = 7/22 (32%) Query 7 QKSVKTSYE-------LCEDVI 21 QK++KT+++ +CE+V+ Sbjct 28 QKTLKTTFDSGYLVPIMCEEVL 49 Lambda K H a alpha 0.319 0.134 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3645348