bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_1 Length=54 Score E Sequences producing significant alignments: (Bits) Value Gokush_Human_gut_33_003_Microviridae_AG062_putative.VP2 53.9 4e-12 Gokush_Human_feces_A_020_Microviridae_AG0263_putative.VP2 42.4 4e-08 Gokush_Human_feces_A_019_Microviridae_AG0437_putative.VP2 42.4 4e-08 Gokush_Human_feces_E_017_Microviridae_AG0128_putative.VP2 42.4 5e-08 Gokush_gi|12085145|ref|NP_073537.1|_putative_replication_initia... 21.6 0.55 Gokush_Human_feces_D_014_Microviridae_AG029_putative.VP1 19.6 2.5 Gokush_Human_gut_36_019_Microviridae_AG0279_putative.VP1 19.2 3.6 Gokush_Human_gut_37_015_Microviridae_AG033_putative.VP1 19.2 3.7 Gokush_Human_gut_35_025_Microviridae_AG0361_putative.VP1 19.2 3.7 Gokush_Human_gut_34_012_Microviridae_AG058_putative.VP1 19.2 3.7 > Gokush_Human_gut_33_003_Microviridae_AG062_putative.VP2 Length=295 Score = 53.9 bits (128), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%) Query 30 QDRSIKPQDKTGSYGEKRKPGDYLK 54 QDR+IKPQDKTG YGEKRKPGDYLK Sbjct 271 QDRAIKPQDKTGKYGEKRKPGDYLK 295 > Gokush_Human_feces_A_020_Microviridae_AG0263_putative.VP2 Length=300 Score = 42.4 bits (98), Expect = 4e-08, Method: Composition-based stats. Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%) Query 2 KTLTKVGSDTSEAIKDATAKTEKGKGAEQDRSIKPQDKTGSYGEKRKPGDYLK 54 K + V +E DA K +K DR+IK DKTGSYG++RKPGDYL+ Sbjct 249 KNVEVVTDKVAEPSYDA-GKAQKRVAGSTDRAIKATDKTGSYGQQRKPGDYLR 300 > Gokush_Human_feces_A_019_Microviridae_AG0437_putative.VP2 Length=300 Score = 42.4 bits (98), Expect = 4e-08, Method: Composition-based stats. Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Query 20 AKTEKGKGAEQDRSIKPQDKTGSYGEKRKPGDYLK 54 K +K DR+IK DKTGSYG+KR+PGDYL+ Sbjct 266 GKAQKRVAGSTDRAIKATDKTGSYGQKRQPGDYLR 300 > Gokush_Human_feces_E_017_Microviridae_AG0128_putative.VP2 Length=300 Score = 42.4 bits (98), Expect = 5e-08, Method: Composition-based stats. Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%) Query 2 KTLTKVGSDTSEAIKDATAKTEKGKGAEQDRSIKPQDKTGSYGEKRKPGDYLK 54 K + V +E DA K +K DR+IK DKTGSYG++RKPGDYL+ Sbjct 249 KNVEVVTDKVAEPSYDA-GKAQKRVAGSTDRAIKATDKTGSYGQQRKPGDYLR 300 > Gokush_gi|12085145|ref|NP_073537.1|_putative_replication_initiation_protein_[Bdellovibrio_phage_phiMH2K] Length=315 Score = 21.6 bits (44), Expect = 0.55, Method: Compositional matrix adjust. Identities = 14/39 (36%), Positives = 17/39 (44%), Gaps = 1/39 (3%) Query 10 DTSEAIKDATAKTEKGKGAEQDRSIKPQDKTGSYGEKRK 48 D IK K +G E R + P TG YG+K K Sbjct 84 DFDLFIKRLNEKLNRGLSKENRRPL-PYMVTGEYGDKTK 121 > Gokush_Human_feces_D_014_Microviridae_AG029_putative.VP1 Length=578 Score = 19.6 bits (39), Expect = 2.5, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 9/19 (47%), Gaps = 0/19 (0%) Query 36 PQDKTGSYGEKRKPGDYLK 54 PQ TG+Y G Y K Sbjct 396 PQGNTGAYSLTGSQGSYFK 414 > Gokush_Human_gut_36_019_Microviridae_AG0279_putative.VP1 Length=582 Score = 19.2 bits (38), Expect = 3.6, Method: Composition-based stats. Identities = 6/8 (75%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 44 GEKRKPGD 51 GEK+ PGD Sbjct 101 GEKKNPGD 108 > Gokush_Human_gut_37_015_Microviridae_AG033_putative.VP1 Length=582 Score = 19.2 bits (38), Expect = 3.7, Method: Composition-based stats. Identities = 6/8 (75%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 44 GEKRKPGD 51 GEK+ PGD Sbjct 101 GEKKNPGD 108 > Gokush_Human_gut_35_025_Microviridae_AG0361_putative.VP1 Length=582 Score = 19.2 bits (38), Expect = 3.7, Method: Composition-based stats. Identities = 6/8 (75%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 44 GEKRKPGD 51 GEK+ PGD Sbjct 101 GEKKNPGD 108 > Gokush_Human_gut_34_012_Microviridae_AG058_putative.VP1 Length=582 Score = 19.2 bits (38), Expect = 3.7, Method: Composition-based stats. Identities = 6/8 (75%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 44 GEKRKPGD 51 GEK+ PGD Sbjct 101 GEKKNPGD 108 Lambda K H a alpha 0.300 0.122 0.322 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3709748