bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-32_CDS_annotation_glimmer3.pl_2_1 Length=60 Score E Sequences producing significant alignments: (Bits) Value gi|547920047|ref|WP_022322418.1| putative uncharacterized protein 85.1 2e-18 gi|492501772|ref|WP_005867312.1| hypothetical protein 52.8 2e-06 gi|649555290|gb|KDS61827.1| hypothetical protein M095_3809 42.4 0.006 gi|655152954|ref|WP_028599645.1| peptidase M32 33.9 6.4 >gi|547920047|ref|WP_022322418.1| putative uncharacterized protein [Parabacteroides merdae CAG:48] gi|524592959|emb|CDD13571.1| putative uncharacterized protein [Parabacteroides merdae CAG:48] Length=259 Score = 85.1 bits (209), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 1/60 (2%) Query 1 MEALRKLRQDNDINAFRYSMERVFGNSSDVKDVASELVKRMGLLLMRPDIKELDQMFNPK 60 ME +RKL+QDNDINAFR MER+FG+SSD K+VASEL KRM + + R D +ELDQMFNPK Sbjct 201 MEGIRKLQQDNDINAFRNRMERLFGDSSDAKNVASELFKRMMMYMFR-DSRELDQMFNPK 259 >gi|492501772|ref|WP_005867312.1| hypothetical protein [Parabacteroides distasonis] gi|409230405|gb|EKN23269.1| hypothetical protein HMPREF1059_03254 [Parabacteroides distasonis CL09T03C24] Length=288 Score = 52.8 bits (125), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 7/60 (12%) Query 1 MEALRKLRQDNDINAFRYSMERVFGNSSDVKDVASELVKRMGLLLMRPDIKELDQMFNPK 60 ++++R+L+QDNDINAFR MERV G SS A+++++R+ ++ +RP D++FNPK Sbjct 236 LQSVRQLQQDNDINAFRNEMERVTGKSS----FATDMLRRL-IMALRPSAN--DRLFNPK 288 >gi|649555290|gb|KDS61827.1| hypothetical protein M095_3809 [Parabacteroides distasonis str. 3999B T(B) 4] gi|649557306|gb|KDS63785.1| hypothetical protein M095_3404 [Parabacteroides distasonis str. 3999B T(B) 4] gi|649559158|gb|KDS65545.1| hypothetical protein M096_4689 [Parabacteroides distasonis str. 3999B T(B) 6] gi|649560567|gb|KDS66875.1| hypothetical protein M095_2448 [Parabacteroides distasonis str. 3999B T(B) 4] gi|649561016|gb|KDS67303.1| hypothetical protein M095_2410 [Parabacteroides distasonis str. 3999B T(B) 4] gi|649562727|gb|KDS68911.1| hypothetical protein M096_3341 [Parabacteroides distasonis str. 3999B T(B) 6] Length=288 Score = 42.4 bits (98), Expect = 0.006, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 7/60 (12%) Query 1 MEALRKLRQDNDINAFRYSMERVFGNSSDVKDVASELVKRMGLLLMRPDIKELDQMFNPK 60 ++++R+L QDNDINAFRY +E++ G K + + R L ++ P+ + D++FNPK Sbjct 236 LQSVRQLTQDNDINAFRYRIEKITG-----KGPLLDDLIRRLLTILAPN--DFDRLFNPK 288 >gi|655152954|ref|WP_028599645.1| peptidase M32 [Paenibacillus pasadenensis] Length=497 Score = 33.9 bits (76), Expect = 6.4, Method: Composition-based stats. Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 4/59 (7%) Query 3 ALRKLRQDNDINAFRYSMERVFGNSSDVKDVASELVKRMGLLL--MRPD--IKELDQMF 57 A + R+DND AF+ +ERV G ++ D+ R LL PD ++ELD++F Sbjct 112 AWEQARKDNDFPAFQGYLERVIGYTNQFIDLWGPKATRYDTLLDDYEPDMTVQELDEIF 170 Lambda K H a alpha 0.321 0.136 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 430540141590