bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-34_CDS_annotation_glimmer3.pl_2_3 Length=90 Score E Sequences producing significant alignments: (Bits) Value gi|496719354|ref|WP_009351619.1| Tat pathway signal protein 36.6 1.4 gi|630172788|ref|XP_007842666.1| hypothetical protein Moror_481 35.0 4.4 gi|631387188|ref|XP_007927974.1| hypothetical protein MYCFIDRAFT... 34.3 7.5 gi|653135358|ref|WP_027384707.1| FAD-linked oxidase 33.9 8.6 gi|674247507|gb|KFK40272.1| lov kelch protein 2 33.9 >gi|496719354|ref|WP_009351619.1| Tat pathway signal protein [Veillonella sp. oral taxon 158] gi|313441997|gb|EFR60419.1| Tat pathway signal sequence domain protein [Veillonella sp. oral taxon 158 str. F0412] Length=3831 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 14/93 (15%) Query 2 DQQEAVKWAYGQDVV------------KVTCIKQGEDDKFVLTVGQY--SVTPIIFDTQE 47 + K ++G D V KVT +++G DD + V Q S T + D Q Sbjct 3583 NNSNGPKLSFGGDTVNITGGNLNMGGNKVTNVQRGTDDNDAVNVKQLKDSRTTLTSDDQS 3642 Query 48 QAETFLETKFKLTNFDLAVIGAMCQRLNELNEQ 80 ET N+DL+V GA+ R+++LNE+ Sbjct 3643 VVLKKTETADGGLNYDLSVKGAVDPRVDQLNEE 3675 >gi|630172788|ref|XP_007842666.1| hypothetical protein Moror_481 [Moniliophthora roreri MCA 2997] gi|554917015|gb|ESK98045.1| hypothetical protein Moror_481 [Moniliophthora roreri MCA 2997] Length=426 Score = 35.0 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 25/72 (35%), Positives = 31/72 (43%), Gaps = 5/72 (7%) Query 9 WAYGQDVVKVTCIKQGEDDKFVLTVGQYSVTP----IIFDTQEQAETFLETKFKLTNFDL 64 W GQ V V +GED K ++ YS P +FD A LE F L N D Sbjct 310 WCEGQVRVHVDWAAKGEDGKPIVQSAAYSTVPNEAFKVFDLSRPAH-ILEIYFLLRNIDQ 368 Query 65 AVIGAMCQRLNE 76 GA +R+ E Sbjct 369 WTTGAFKERVTE 380 >gi|631387188|ref|XP_007927974.1| hypothetical protein MYCFIDRAFT_46458 [Pseudocercospora fijiensis CIRAD86] gi|452981117|gb|EME80877.1| hypothetical protein MYCFIDRAFT_46458 [Pseudocercospora fijiensis CIRAD86] Length=437 Score = 34.3 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 0/34 (0%) Query 27 DKFVLTVGQYSVTPIIFDTQEQAETFLETKFKLT 60 DK VLTVG YS T + F +Q QA ++ T +LT Sbjct 213 DKIVLTVGAYSDTLLDFKSQLQATAYVVTHVRLT 246 >gi|653135358|ref|WP_027384707.1| FAD-linked oxidase [Chryseobacterium caeni] Length=440 Score = 33.9 bits (76), Expect = 8.6, Method: Compositional matrix adjust. Identities = 23/72 (32%), Positives = 35/72 (49%), Gaps = 10/72 (14%) Query 18 VTCIKQGEDDKFVLTVGQYSVTPIIFDTQEQAETFLETKFKLTNFDLAVIGAMCQRLNEL 77 +TC ++ DKF T+G +T II L KFKL N + A I + L Sbjct 147 ITCSREENSDKFWATIGGMGLTGII----------LSAKFKLKNIESAYIRQESIKAENL 196 Query 78 NEQNKLYSKNEE 89 +E KL+ ++E+ Sbjct 197 DEVFKLFDESED 208 >gi|674247507|gb|KFK40272.1| lov kelch protein 2 [Arabis alpina] Length=618 Score = 33.9 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (61%), Gaps = 2/56 (4%) Query 31 LTVGQYSVTPIIFDTQEQAETFLETKF--KLTNFDLAVIGAMCQRLNELNEQNKLY 84 L +G+ +V+ + E ++ L +K +LT D+A +G +CQRLNEL + + ++ Sbjct 181 LPIGERNVSRGLCGIFELSDEVLASKILSQLTPRDIASVGCVCQRLNELTKNDDVW 236 Lambda K H a alpha 0.315 0.131 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438678852570