bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_6 Length=65 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01606 46.2 2e-05 > 469590.BSCG_01606 Length=69 Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Query 1 MKITPQQWIEIVKLISTFIIGVITCLFVQSC--TASMSISKYNSNSSQSTEQTSTSSVDS 58 MK+T QW I++ I T ++ + + V SC T SMS+ K NS+S+Q EQ S S DS Sbjct 1 MKLTSDQWNRIIQAIVTAVVTICNIILVSSCAVTMSMSVQKNNSSSTQQIEQKSESRNDS 60 Query 59 TKISI 63 T + + Sbjct 61 TTLDL 65 Lambda K H a alpha 0.313 0.121 0.324 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127741675040