bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-30_CDS_annotation_glimmer3.pl_2_5 Length=77 Score E Sequences producing significant alignments: (Bits) Value 658187.LDG_8407 37.0 0.17 > 658187.LDG_8407 Length=287 Score = 37.0 bits (84), Expect = 0.17, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Query 19 LLETDNPELSEKLREARKNLAKEISRCKLSQ-TDKRYMNMLDTEEEVKQE 67 L E + PEL+ + R+A +L I+ KL+Q T KR++N+L T+ KQE Sbjct 13 LAEIETPELNAQKRQAAADLNTAIANNKLAQSTAKRWINLLKTDSVSKQE 62 Lambda K H a alpha 0.313 0.129 0.346 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127558583650