bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-32_CDS_annotation_glimmer3.pl_2_4 Length=119 Score E Sequences producing significant alignments: (Bits) Value 598659.NAMH_1781 33.1 5.5 > 598659.NAMH_1781 Length=109 Score = 33.1 bits (74), Expect = 5.5, Method: Compositional matrix adjust. Identities = 22/71 (31%), Positives = 36/71 (51%), Gaps = 3/71 (4%) Query 44 GMPVSSGVRSGDYPDHDQDFDDVLPTEDPDFDLADYATLKNDLADRERQRKIDMEKAYKE 103 + VS + +G+ +H Q + +D +++AD LAD + ID+EKA+ E Sbjct 27 NLAVSISIEAGELLEHFQWKEGCENKKDISYEMADILAYLLLLAD---ECSIDLEKAFLE 83 Query 104 KLEKEKTPDPA 114 K+E K PA Sbjct 84 KMEINKKKYPA 94 Lambda K H a alpha 0.312 0.133 0.373 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126498956430