bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-53_CDS_annotation_glimmer3.pl_2_1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 401053.AciPR4_2106 34.7 7.4 > 401053.AciPR4_2106 Length=1821 Score = 34.7 bits (78), Expect = 7.4, Method: Composition-based stats. Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 5/96 (5%) Query 32 SPSIQSVFTQLLKMSLSYVFSTSP-PSLFADAILIASNRLLTSLSPVSVIFNAIFPGCFN 90 +PS +V TQ++K S V + SP PSL D++L ++ +++ P ++ A G + Sbjct 682 APSTSAVLTQIVKQGPSVVLTASPNPSLVGDSVLFSAKVTTSTIQPSGLV--AFKDGATS 739 Query 91 ISSRIL--SRVSSFCSFKIVFSEFLYNVSSPGNCPT 124 I S L S V++F + +V S G+ T Sbjct 740 IGSGSLNGSGVATFATTALVAGSHSITASYVGDANT 775 Lambda K H a alpha 0.328 0.139 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125881010080