bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-27_CDS_annotation_glimmer3.pl_2_2 Length=69 Score E Sequences producing significant alignments: (Bits) Value hao:PCC7418_1425 restriction modification system DNA specifici... 32.7 4.8 ssc:100519813 homeobox protein TGIF2LX-like 31.6 7.3 ani:AN8150.2 hypothetical protein 32.3 8.1 > hao:PCC7418_1425 restriction modification system DNA specificity domain-containing protein Length=400 Score = 32.7 bits (73), Expect = 4.8, Method: Compositional matrix adjust. Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query 14 HNDIVDGIPESYVHYFKQYLYEIEDRR-ISQNTDVSVRPLDALSETGI 60 H+ I+DGIPE + + EI + I + +V P+ ALSETG+ Sbjct 199 HSPIIDGIPEGWEKVSVPEIIEINPKETIEKEKEVWYIPMSALSETGM 246 > ssc:100519813 homeobox protein TGIF2LX-like Length=149 Score = 31.6 bits (70), Expect = 7.3, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%) Query 25 YVHYFKQYLYEIEDRRISQNTDVS 48 Y H+FK Y EIE R +S+ TD+S Sbjct 58 YEHWFKAYPSEIEKRMLSEQTDLS 81 > ani:AN8150.2 hypothetical protein Length=1773 Score = 32.3 bits (72), Expect = 8.1, Method: Composition-based stats. Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 2/57 (4%) Query 2 AYDIDIETFPTIHNDIVDGIPESYVHYFKQYLYEIEDRRISQNTDV--SVRPLDALS 56 +YD + + +HND+VD + + +F++ R SQ+ D+ PLDALS Sbjct 1286 SYDHGVSSALKLHNDLVDNTARASLQFFQRVDIGSITNRFSQDLDLVDMSLPLDALS 1342 Lambda K H a alpha 0.322 0.142 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127067169544