bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-27_CDS_annotation_glimmer3.pl_2_6 Length=66 Score E Sequences producing significant alignments: (Bits) Value rto:RTO_19290 hypothetical protein 32.7 3.1 cci:CC1G_05894 pirin domain-containing protein domain-containi... 32.0 6.7 > rto:RTO_19290 hypothetical protein Length=221 Score = 32.7 bits (73), Expect = 3.1, Method: Composition-based stats. Identities = 15/47 (32%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 18 NNAGKFIDGLSNIVGAVTKFGSFRREGRSVIEQFDDNQGYSSTRQRY 64 N KF++ + I+G + SFR ++ + +DNQ YS T Y Sbjct 79 NARCKFLNDENKIIGNELELKSFRELANKILNKSNDNQVYSETENEY 125 > cci:CC1G_05894 pirin domain-containing protein domain-containing protein Length=266 Score = 32.0 bits (71), Expect = 6.7, Method: Compositional matrix adjust. Identities = 17/62 (27%), Positives = 32/62 (52%), Gaps = 1/62 (2%) Query 2 DRWSQDPVKARWDRGINNAGKFIDGLSNIVGAVTKFGSFRREGRSVIEQFDDNQGYSSTR 61 D+W++ V W +GI + + DG + + A+T + S EG+++ + +GY Sbjct 146 DQWAK-VVAPAWSKGIKTSERNGDGPAPVNSALTLYSSILGEGKALDRPLEGKKGYIHVI 204 Query 62 QR 63 QR Sbjct 205 QR 206 Lambda K H a alpha 0.320 0.136 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128263368604