bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-39_CDS_annotation_glimmer3.pl_2_2 Length=716 Score E Sequences producing significant alignments: (Bits) Value ath:AT1G35240 ARF20; auxin response factor 20 38.9 ath:AT1G34390 ARF22; auxin response factor 22 38.5 ath:AT1G34310 ARF12; auxin response factor 12 38.5 paea:R70723_11095 cystathionine beta-lyase 38.1 6.3 > ath:AT1G35240 ARF20; auxin response factor 20 Length=590 Score = 38.9 bits (89), Expect = 4.5, Method: Compositional matrix adjust. Identities = 19/53 (36%), Positives = 27/53 (51%), Gaps = 3/53 (6%) Query 600 QELLSQEMHGRAWRVNANYKTTDFSVGKQPAWTEYTTTVNETYGD---FAAGE 649 QELL++++HG WR +Y+ T W E+TT+ GD F GE Sbjct 160 QELLAKDLHGNQWRFRHSYRGTPQRHSLTTGWNEFTTSKKLVKGDVIVFVRGE 212 > ath:AT1G34390 ARF22; auxin response factor 22 Length=598 Score = 38.5 bits (88), Expect = 5.3, Method: Compositional matrix adjust. Identities = 20/53 (38%), Positives = 26/53 (49%), Gaps = 3/53 (6%) Query 600 QELLSQEMHGRAWRVNANYKTTDFSVGKQPAWTEYTTTVNETYGD---FAAGE 649 QELL+ ++HG WR N NY+ T W +TT+ GD F GE Sbjct 162 QELLATDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGE 214 > ath:AT1G34310 ARF12; auxin response factor 12 Length=593 Score = 38.5 bits (88), Expect = 5.6, Method: Compositional matrix adjust. Identities = 23/64 (36%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Query 592 PNLDQ---IGFQELLSQEMHGRAWRVNANYKTTDFSVGKQPAWTEYTTTVNETYGD---F 645 P+LD + QELL+ ++HG WR N NY+ T W +TT+ GD F Sbjct 153 PSLDMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVF 212 Query 646 AAGE 649 GE Sbjct 213 VRGE 216 > paea:R70723_11095 cystathionine beta-lyase Length=394 Score = 38.1 bits (87), Expect = 6.3, Method: Compositional matrix adjust. Identities = 32/96 (33%), Positives = 45/96 (47%), Gaps = 17/96 (18%) Query 403 KTESGVQVYGRTTSQCGLGIRTYLSDRFNNWLNTEWIDGTNGINEITSVDVTSGLLTM-- 460 + ESG+ Y T I ++ S R N L TEWI + GI +TS+ + L T Sbjct 53 RVESGIYGYSVTGESYRQAIVSWYSRRHNWELQTEWITDSPGI--VTSLSLAVELFTQPG 110 Query 461 DALILQKKV----YDMLNR---------IAVSGGSY 483 D +ILQ V YD++N + +SGG Y Sbjct 111 DEVILQSPVYYPFYDVINMNDRKVAKNPLILSGGRY 146 Lambda K H a alpha 0.316 0.133 0.388 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1723287003652