bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-20_CDS_annotation_glimmer3.pl_2_3 Length=53 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_B_007_Microviridae_AG068_putative.VP1 20.0 1.7 Alpavirinae_Human_feces_A_016_Microviridae_AG001_putative.VP1 19.6 2.8 Gokush_Human_feces_E_009_Microviridae_AG0285_putative.VP1 18.9 4.3 Gokush_gi|17402855|ref|NP_510879.1|_hypothetical_protein_PhiCPG... 18.9 4.7 Gokush_gi|47566147|ref|YP_022485.1|_nonstructural_protein_[Chla... 18.9 5.0 Alpavirinae_Human_feces_D_015_Microviridae_AG018_hypothetical.p... 18.9 5.3 Gokush_gi|77020121|ref|YP_338244.1|_putative_replication_protei... 18.9 5.3 Alpavirinae_Human_feces_B_023_Microviridae_AG0144_hypothetical.... 18.5 5.3 Gokush_gi|9634955|ref|NP_054653.1|_nonstructural_protein_[Chlam... 18.5 6.8 Alpavirinae_Human_gut_24_085_Microviridae_AG0230_putative.VP1 18.1 9.3 > Alpavirinae_Human_feces_B_007_Microviridae_AG068_putative.VP1 Length=780 Score = 20.0 bits (40), Expect = 1.7, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 11/20 (55%), Gaps = 0/20 (0%) Query 15 FRTYEQASEYLSFMTELYPG 34 FR++E A E T + PG Sbjct 723 FRSFENAPELGKSFTVMQPG 742 > Alpavirinae_Human_feces_A_016_Microviridae_AG001_putative.VP1 Length=657 Score = 19.6 bits (39), Expect = 2.8, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 0/34 (0%) Query 2 RKRVGKCFKVICRFRTYEQASEYLSFMTELYPGV 35 + +G K+ R R Y+ +S LS++ GV Sbjct 9 KNTLGDNNKMKVRLREYDMSSHNLSYVFRSTMGV 42 > Gokush_Human_feces_E_009_Microviridae_AG0285_putative.VP1 Length=559 Score = 18.9 bits (37), Expect = 4.3, Method: Composition-based stats. Identities = 6/14 (43%), Positives = 10/14 (71%), Gaps = 0/14 (0%) Query 27 FMTELYPGVYFDIK 40 ++ E+ PG FD+K Sbjct 42 YVDEVLPGDTFDVK 55 > Gokush_gi|17402855|ref|NP_510879.1|_hypothetical_protein_PhiCPG1p9_[Guinea_pig_Chlamydia_phage] Length=263 Score = 18.9 bits (37), Expect = 4.7, Method: Compositional matrix adjust. Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 0/36 (0%) Query 11 VICRFRTYEQASEYLSFMTELYPGVYFDIKDVCRSY 46 ++C + A Y + ++YP Y ++D +S+ Sbjct 163 LMCSLKPGIGADWYEKYKRDVYPQDYLVVQDKGKSF 198 > Gokush_gi|47566147|ref|YP_022485.1|_nonstructural_protein_[Chlamydia_phage_3] Length=315 Score = 18.9 bits (37), Expect = 5.0, Method: Compositional matrix adjust. Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 0/36 (0%) Query 11 VICRFRTYEQASEYLSFMTELYPGVYFDIKDVCRSY 46 ++C + A Y + ++YP Y ++D +S+ Sbjct 215 LMCSLKPGIGADWYEKYKRDVYPQDYLVVQDKGKSF 250 > Alpavirinae_Human_feces_D_015_Microviridae_AG018_hypothetical.protein.BACEGG.02723 Length=427 Score = 18.9 bits (37), Expect = 5.3, Method: Composition-based stats. Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%) Query 37 FDIKDVCRSYLDKESG 52 F +KD +S +DK G Sbjct 171 FSLKDYLQSQIDKMKG 186 > Gokush_gi|77020121|ref|YP_338244.1|_putative_replication_protein_[Chlamydia_phage_4] Length=315 Score = 18.9 bits (37), Expect = 5.3, Method: Compositional matrix adjust. Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 0/36 (0%) Query 11 VICRFRTYEQASEYLSFMTELYPGVYFDIKDVCRSY 46 ++C + A Y + ++YP Y ++D +S+ Sbjct 215 LMCSLKPGIGADWYEKYKRDVYPQDYLVVQDKGKSF 250 > Alpavirinae_Human_feces_B_023_Microviridae_AG0144_hypothetical.protein Length=87 Score = 18.5 bits (36), Expect = 5.3, Method: Compositional matrix adjust. Identities = 6/22 (27%), Positives = 12/22 (55%), Gaps = 0/22 (0%) Query 5 VGKCFKVICRFRTYEQASEYLS 26 +G+ +F+T E+A Y+ Sbjct 23 IGRHLATEKKFKTKEEAQAYID 44 > Gokush_gi|9634955|ref|NP_054653.1|_nonstructural_protein_[Chlamydia_phage_2] Length=336 Score = 18.5 bits (36), Expect = 6.8, Method: Compositional matrix adjust. Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 0/36 (0%) Query 11 VICRFRTYEQASEYLSFMTELYPGVYFDIKDVCRSY 46 ++C + A Y + ++YP Y ++D +S+ Sbjct 236 LMCSLKPGIGADWYEKYKCDVYPQDYLVVQDKGKSF 271 > Alpavirinae_Human_gut_24_085_Microviridae_AG0230_putative.VP1 Length=653 Score = 18.1 bits (35), Expect = 9.3, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 19/36 (53%), Gaps = 2/36 (6%) Query 2 RKRVGKCFKVICRFRTYEQASEYLSFM--TELYPGV 35 + +G K+ + YE ++ LSF+ + + PG+ Sbjct 7 KNTIGDNNKMSLSLKDYEMSTHDLSFVFRSTMAPGL 42 Lambda K H a alpha 0.328 0.143 0.442 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3725848