bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_6 Length=107 Score E Sequences producing significant alignments: (Bits) Value gi|652586145|ref|WP_026974104.1| macrolide ABC transporter ATP-b... 35.0 4.8 >gi|652586145|ref|WP_026974104.1| macrolide ABC transporter ATP-binding protein [Alicyclobacillus contaminans] Length=238 Score = 35.0 bits (79), Expect = 4.8, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 0/31 (0%) Query 72 EKMDRARKAKKEQGVKPEDFGKDVPNKLEGG 102 E M+RA KA G+ PE+ G++ PN+L GG Sbjct 117 EAMERAAKALVRVGLNPEEKGRNAPNQLSGG 147 Lambda K H a alpha 0.315 0.136 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 428991919341