bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_7 Length=75 Score E Sequences producing significant alignments: (Bits) Value gi|443894967|dbj|GAC72313.1| hypothetical protein PANT_7c00034 35.8 1.9 gi|674220564|dbj|GAK64183.1| conserved hypothetical protein 35.8 2.3 >gi|443894967|dbj|GAC72313.1| hypothetical protein PANT_7c00034 [Pseudozyma antarctica T-34] Length=1263 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 10/76 (13%) Query 10 VYYYQKGYITIYAYSGFRSNANRK---------FRSYLASNFPNYQSSVFRVLTYSSIMS 60 VY +Q+G++ + AY+ +R R F ++LA + S++F +L+ ++ S Sbjct 274 VYVHQRGFLDLEAYNAWRDQERRSHYSHSAFDHFLAHLAPDNARLLSALFELLSSTASYS 333 Query 61 MLHG-YPSISCASFNP 75 + +G P+ C F P Sbjct 334 LTNGMMPAKLCKHFGP 349 >gi|674220564|dbj|GAK64183.1| conserved hypothetical protein [Pseudozyma antarctica] Length=1257 Score = 35.8 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 40/76 (53%), Gaps = 10/76 (13%) Query 10 VYYYQKGYITIYAYSGFRSNANRK---------FRSYLASNFPNYQSSVFRVLTYSSIMS 60 VY +Q+G++ + AY+ +R + R F ++LA + S++F +L+ ++ S Sbjct 274 VYVHQRGFLDLEAYNAWRDHERRSHYSHSAFDHFLAHLAPDNARLLSALFELLSSTASYS 333 Query 61 MLHG-YPSISCASFNP 75 + +G P+ C F P Sbjct 334 LKNGMMPAKLCKHFGP 349 Lambda K H a alpha 0.323 0.133 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 443954776629