bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-20_CDS_annotation_glimmer3.pl_2_1 Length=272 Score E Sequences producing significant alignments: (Bits) Value gi|544919785|ref|WP_021329255.1| hypothetical protein 41.2 0.84 gi|475623815|gb|EMT32377.1| Putative beta-1,3-galactosyltransfer... 37.7 8.7 >gi|544919785|ref|WP_021329255.1| hypothetical protein [Treponema socranskii] gi|538293860|gb|ERF61708.1| hypothetical protein HMPREF1325_1344 [Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536] gi|544005847|gb|ERK05105.1| hypothetical protein HMPREF0860_1608 [Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536] Length=1341 Score = 41.2 bits (95), Expect = 0.84, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 2/57 (4%) Query 98 KARTGYIDDQI--EAELQLLTARALYLKSSSSNQEQLARVNELTADDLENWFDVNWN 152 +++TG++ ++I E E +L T L +KS++SNQ++L ++N +T W V W+ Sbjct 383 ESKTGFVPEKIIGETEAKLSTTIGLKIKSTTSNQDKLKKINVITCGTARTWNGVQWS 439 >gi|475623815|gb|EMT32377.1| Putative beta-1,3-galactosyltransferase 8 [Aegilops tauschii] Length=1379 Score = 37.7 bits (86), Expect = 8.7, Method: Compositional matrix adjust. Identities = 26/101 (26%), Positives = 49/101 (49%), Gaps = 6/101 (6%) Query 109 EAELQLLTARALYLKSSSSNQEQLARVNELTADDLENWFDVNWNTKVQVPIINEKGKVER 168 E EL+LL + L ++ + ++ ++L + L ++L N+ W + VPI KG V+ Sbjct 368 ETELRLLDSAPLSVQRNPTDDQKLIK---LLQEELRNYMPEEWRRSILVPIFKNKGDVQS 424 Query 169 TVEMTGKEIRREYMKLNLQDFQYDMYTNRWELRSEKNRFGY 209 G ++ MKL + ++ + R KN+FG+ Sbjct 425 CTNYRGIKLMSHTMKLWERVIEHRL---RRMTSVTKNQFGF 462 Lambda K H a alpha 0.311 0.126 0.347 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1327997764878