bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-20_CDS_annotation_glimmer3.pl_2_2 Length=135 Score E Sequences producing significant alignments: (Bits) Value gi|553739139|ref|WP_023073340.1| nadph:quinone reductase 35.8 5.6 >gi|553739139|ref|WP_023073340.1| nadph:quinone reductase [Leptolyngbya sp. Heron Island J] gi|553084146|gb|ESA35842.1| nadph:quinone reductase [Leptolyngbya sp. Heron Island J] Length=324 Score = 35.8 bits (81), Expect = 5.6, Method: Compositional matrix adjust. Identities = 27/94 (29%), Positives = 46/94 (49%), Gaps = 12/94 (13%) Query 36 YLVSFSQEEPNGSFKSYDPSYSLDFEASKLSTYLDYSSIFLPKGCYYLSDMELAGFIKAL 95 +L+ +++E+ + + YD L F A+ ++ DY + G Y + ELA ++AL Sbjct 190 HLIDYTREDLTANGQQYD----LIFAANGYNSIFDYRRVLGSTGIYVAAGGELAQILQAL 245 Query 96 SFGA--STFEMKLLPASAQMQGMILVQVDEKSLS 127 G S F K Q+ M + Q++EK LS Sbjct 246 LVGPMLSKFGRK------QLSFMGITQIEEKDLS 273 Lambda K H a alpha 0.312 0.130 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 428847735324