bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-23_CDS_annotation_glimmer3.pl_2_4 Length=90 Score E Sequences producing significant alignments: (Bits) Value gi|83320227|gb|ABC02792.1| putative cytochrome P450 enzyme 34.3 6.9 >gi|83320227|gb|ABC02792.1| putative cytochrome P450 enzyme [Actinomadura melliaura] Length=401 Score = 34.3 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 17/45 (38%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query 4 QEAVKWAYRQDVVKVSCVKEGEEDKFILTVGQYNVTPIVFDTQEQ 48 Q +WAY+ DVV +K G DK +L +G N P FD ++ Sbjct 286 QMVTRWAYQDDVVHGRKIKRG--DKVVLVLGSANRDPSRFDRPDE 328 Lambda K H a alpha 0.322 0.135 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438678852570