bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-34_CDS_annotation_glimmer3.pl_2_2 Length=59 Score E Sequences producing significant alignments: (Bits) Value gi|91079160|ref|XP_967064.1| PREDICTED: E3 SUMO-protein ligase R... 35.4 2.4 gi|653655108|gb|KEA62164.1| CopG protein 33.5 4.0 >gi|91079160|ref|XP_967064.1| PREDICTED: E3 SUMO-protein ligase RanBP2 [Tribolium castaneum] gi|270003619|gb|EFA00067.1| hypothetical protein TcasGA2_TC002881 [Tribolium castaneum] Length=2779 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 22/58 (38%), Positives = 29/58 (50%), Gaps = 12/58 (21%) Query 4 SVLKTAADGTKGAIFGGSS-----------YTTGDSLQKASSAPV-PAYDGYVAPVKI 49 S+ T A T G+IFGGS + GDSL KA+ +PV P + VAP + Sbjct 2312 SLFGTPATTTTGSIFGGSPAVFGKGTNKPIFGGGDSLAKATESPVRPVFGAAVAPTDV 2369 >gi|653655108|gb|KEA62164.1| CopG protein [Marinobacterium sp. AK27] Length=172 Score = 33.5 bits (75), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 15 GAIFGGSSYTTGDSLQKASSAPVPAYDGYVAPVKISFYRSSTC 57 GAI G+S + +++ P + DG V+PV++ Y+S TC Sbjct 10 GAILLGTSLLLSACSESSATDPSASVDGKVSPVELELYKSPTC 52 Lambda K H a alpha 0.317 0.130 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 431863444341