bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-5_CDS_annotation_glimmer3.pl_2_2 Length=57 Score E Sequences producing significant alignments: (Bits) Value gi|651851093|ref|WP_026636572.1| hypothetical protein 32.0 4.2 >gi|651851093|ref|WP_026636572.1| hypothetical protein [Dyella japonica] Length=69 Score = 32.0 bits (71), Expect = 4.2, Method: Compositional matrix adjust. Identities = 17/40 (43%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 13 SDYRHFSVEASSFSDAEKTANAFALRVGAIIVGILSEHLL 52 DY+ F + S +AE+T FA+R G IV I SE L Sbjct 6 GDYKGFQYDISFVGNAEQTVCVFAIRFGEDIVDIRSEMFL 45 Lambda K H a alpha 0.323 0.134 0.364 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 434510049843