bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-11_CDS_annotation_glimmer3.pl_2_5 Length=93 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000060160 37.0 0.40 > 9598.ENSPTRP00000060160 Length=1338 Score = 37.0 bits (84), Expect = 0.40, Method: Composition-based stats. Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 3/74 (4%) Query 17 TTQEEKEYMIVIGKHLATTEKFPTREAAEEKINSVDWNLIAAMIYACKEADEYEKKLKRS 76 T+Q E+E GK +++ + FPT+E +N D + IAA +YAC + K + + Sbjct 908 TSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTD-DQIAAGLYACTNNESTLKSIMK- 965 Query 77 AKKVTKKIINDAKK 90 KK K N AKK Sbjct 966 -KKDGNKDSNGAKK 978 Lambda K H a alpha 0.311 0.126 0.343 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125263167000