bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-17_CDS_annotation_glimmer3.pl_2_5 Length=511 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01608 109 5e-23 > 469590.BSCG_01608 Length=497 Score = 109 bits (273), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 1/104 (1%) Query 132 IPFLNYVDVQNYIKRLRKYLFKVLGSYESLHFYAVGEYGPVHFRPHFHLLLFTNSDEVAE 191 +P+L D+Q ++KRLR Y+ K S E + ++AVGEYGPVHFRPH+HLLLF SDE + Sbjct 117 VPYLRKTDLQLFLKRLRYYVTKQKPS-EKVRYFAVGEYGPVHFRPHYHLLLFLQSDEALQ 175 Query 192 VLRQCHDKSWKFGRSDFQRSAGGSASYVSSYVNSLCSAPLLYRS 235 + + K+W FGR D Q S G ++YV+SYVNS C+ P ++++ Sbjct 176 ICSENISKAWTFGRVDCQVSKGQCSNYVASYVNSSCTIPKVFKA 219 Lambda K H a alpha 0.324 0.138 0.421 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1090181195990