bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-18_CDS_annotation_glimmer3.pl_2_7 Length=639 Score E Sequences producing significant alignments: (Bits) Value 585502.HMPREF0645_0935 49.3 0.002 > 585502.HMPREF0645_0935 Length=519 Score = 49.3 bits (116), Expect = 0.002, Method: Compositional matrix adjust. Identities = 53/231 (23%), Positives = 86/231 (37%), Gaps = 26/231 (11%) Query 343 LDASTDTGFSVAVPELRLKTKLQNWMDRLFVSGGRVGDVFRTLWGVKSSAPYVNKPDFLG 402 +D + G+ +V LR + + +G D R +GV+ + ++LG Sbjct 253 VDVDNNLGY-FSVSSLRSAFAVDKLLSVTMRAGKTFQDQMRAHYGVEIPDSRDGRVNYLG 311 Query 403 VWQASINPSNVRAMANGSASGEDANLGQLAACVDRYCDFSGHSGIDYYAKEPGTFMLIAM 462 + + + S+V + +A+ G L + SG I + AKE G M I Sbjct 312 GFDSDLQVSDVTQTSGTTATEYKPEAGYLGRIAGKGTG-SGRGRIVFDAKEHGVLMCIYS 370 Query 463 LVPEPAY-FQGLHPDLASISFGDDFNPELNGIGFQQVPRHRFTMMPRGMDDITAHQEKNP 521 LVP+ Y L P + + D F PE +G Q + Sbjct 371 LVPQIQYDCTRLDPMVDKLDRFDFFTPEFENLGMQPLNS--------------------- 409 Query 522 WLGYAGTGVTIDPNMASVGEEVAWSWLRTDYPRLHGDFAQNGNYQYWVLAR 572 Y + T DP +G + +S +T HG FAQN W ++R Sbjct 410 --SYISSFCTPDPKNPVLGYQPRYSEYKTALDINHGQFAQNDALSSWSVSR 458 Lambda K H a alpha 0.321 0.140 0.442 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1449799565630