bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-27_CDS_annotation_glimmer3.pl_2_3 Length=83 Score E Sequences producing significant alignments: (Bits) Value 931890.XP_003646172.1 35.0 1.2 > 931890.XP_003646172.1 Length=850 Score = 35.0 bits (79), Expect = 1.2, Method: Compositional matrix adjust. Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Query 13 LSVTPSDIERLARQGIPV---SVPNANSFY----NIDSGLDVPPELKVDADRN 58 L +T SD+ +LA GIPV N + ++ NI+SG+++ PE K+ + N Sbjct 453 LCITKSDLTKLANHGIPVDSFQEDNKDWYFQCVCNIESGVNIDPESKIFSGYN 505 Lambda K H a alpha 0.311 0.127 0.353 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 124970241430