bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-20_CDS_annotation_glimmer3.pl_2_3 Length=53 Score E Sequences producing significant alignments: (Bits) Value spo:SPBC14F5.03c kap123; karyopherin Kap123 32.3 5.5 calo:Cal7507_4517 hypothetical protein 29.6 7.4 > spo:SPBC14F5.03c kap123; karyopherin Kap123 Length=1067 Score = 32.3 bits (72), Expect = 5.5, Method: Composition-based stats. Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 3/52 (6%) Query 1 VRKRVGKCFKVICRFRTYEQASEYLSFMTELYPGVYFDIKDVCRSYLDKESG 52 VR ++C+F T + +SEYL+ + +L P F ++V R+ LD G Sbjct 910 VRSNAAYSMGLLCQFSTEDLSSEYLNILQKLQP---FFTQEVFRTALDNAIG 958 > calo:Cal7507_4517 hypothetical protein Length=61 Score = 29.6 bits (65), Expect = 7.4, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 2/38 (5%) Query 4 RVGKCFKVIC--RFRTYEQASEYLSFMTELYPGVYFDI 39 R G + IC RFR+ A Y+S + L PGV F + Sbjct 14 RCGSTLENICVTRFRSRTDAEAYMSILRGLSPGVRFQV 51 Lambda K H a alpha 0.328 0.143 0.442 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128296444671