bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_8 Length=184 Score E Sequences producing significant alignments: (Bits) Value mze:101483062 protein-methionine sulfoxide oxidase mical3a-like 37.4 1.7 dpp:DICPUDRAFT_150557 hypothetical protein 36.2 3.9 > mze:101483062 protein-methionine sulfoxide oxidase mical3a-like Length=2075 Score = 37.4 bits (85), Expect = 1.7, Method: Composition-based stats. Identities = 21/79 (27%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Query 42 LYLNFSELEGCSAVYRLFLAYRNLCDHWITVPSNHIAFYGQLRRA--FRTIYAFYSYMDS 99 L+ NF + C + + A++ LCDH PS+H FY +L+ + A ++ +D Sbjct 20 LFDNFVQATTCKGILK---AFQELCDHLEVKPSDHRIFYHKLKSKLNYWKAKALWAKLDK 76 Query 100 KHLHDQLLKVRSWSQNNYL 118 + H + K R+ + L Sbjct 77 RASHKEYKKGRACANTKCL 95 > dpp:DICPUDRAFT_150557 hypothetical protein Length=1046 Score = 36.2 bits (82), Expect = 3.9, Method: Composition-based stats. Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 5/99 (5%) Query 19 QVDHSLDNAPEALRFIYNACRLSLYLNFSELEGCSAVYRLFLAYRNLCDHWITVPSNHIA 78 Q + PE+L FIY + + + EL S +Y LF ++ + + NHI Sbjct 542 QFKVKFNQLPESLEFIYISTQNETLKDPIELNKISNLYVLFDNDCSIFNPNSKLYLNHIV 601 Query 79 FYGQLRRAFRTIYAFYSYMDSKHLHDQLLKVRSWSQNNY 117 FY R++F FY + +HL + ++V+ QNNY Sbjct 602 FY---RKSFNQYEDFYRSNEKEHL--RAIRVKVPGQNNY 635 Lambda K H a alpha 0.329 0.139 0.439 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 172592981444