bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-37_CDS_annotation_glimmer3.pl_2_3 Length=91 Score E Sequences producing significant alignments: (Bits) Value Gokush_Human_feces_D_045_Microviridae_AG0399_putative.VP4 26.6 0.024 Gokush_Human_feces_A_029_Microviridae_AG0222_putative.VP4 25.4 0.080 Gokush_Human_feces_E_009_Microviridae_AG0282_putative.VP4 23.9 0.25 Alpavirinae_Human_feces_D_031_Microviridae_AG0425_putative.VP1 21.9 1.1 Gokush_Human_feces_A_013_Microviridae_AG011_putative.VP4 20.8 3.1 Alpavirinae_Human_feces_C_010_Microviridae_AG0198_putative.VP4 20.4 3.8 Alpavirinae_Human_feces_C_016_Microviridae_AG0273_putative.VP4 20.0 5.2 Gokush_Human_gut_32_030_Microviridae_AG0185_putative.VP4 20.0 5.5 Gokush_Human_gut_31_045_Microviridae_AG0114_putative.VP4 20.0 5.5 Gokush_Human_gut_27_035_Microviridae_AG0163_putative.VP4 20.0 5.5 > Gokush_Human_feces_D_045_Microviridae_AG0399_putative.VP4 Length=329 Score = 26.6 bits (57), Expect = 0.024, Method: Compositional matrix adjust. Identities = 11/40 (28%), Positives = 23/40 (58%), Gaps = 3/40 (8%) Query 44 NNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 ++V+ + LRK++ + ++F+ + TQN P H+H Sbjct 108 SDVQKFMKRLRKHFTGTRIRFYLAGEYGTQNLRP---HYH 144 > Gokush_Human_feces_A_029_Microviridae_AG0222_putative.VP4 Length=343 Score = 25.4 bits (54), Expect = 0.080, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 6/56 (11%) Query 35 LLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFHYPDCILF 90 LLP+ S +++ + +RK + D +++ + + P H+H CILF Sbjct 113 LLPLMTLSKRDMQLFMKRVRKRFCDDRIRYFLAGEYGSTTFRP---HYH---CILF 162 > Gokush_Human_feces_E_009_Microviridae_AG0282_putative.VP4 Length=340 Score = 23.9 bits (50), Expect = 0.25, Method: Composition-based stats. Identities = 11/51 (22%), Positives = 22/51 (43%), Gaps = 3/51 (6%) Query 33 GTLLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 G Y + + + LR Y+PD+ ++F + + + P H+H Sbjct 114 GEAFASYSLRKTDFQLFMKRLRYYFPDNKIRFFAAGEYGSHSHRP---HYH 161 > Alpavirinae_Human_feces_D_031_Microviridae_AG0425_putative.VP1 Length=614 Score = 21.9 bits (45), Expect = 1.1, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 3/22 (14%) Query 41 FSGNNVRSSLNSL---RKYYPD 59 +SG NV +SL +L +KYY D Sbjct 230 YSGGNVLASLTTLDLAKKYYSD 251 > Gokush_Human_feces_A_013_Microviridae_AG011_putative.VP4 Length=330 Score = 20.8 bits (42), Expect = 3.1, Method: Composition-based stats. Identities = 10/51 (20%), Positives = 22/51 (43%), Gaps = 3/51 (6%) Query 33 GTLLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 G +P + + + +R+ +PD ++F + +Q P H+H Sbjct 94 GEAIPSLTLCKRDFQLLMKRIRRRFPDDHIRFFACGEYGSQTFRP---HYH 141 > Alpavirinae_Human_feces_C_010_Microviridae_AG0198_putative.VP4 Length=451 Score = 20.4 bits (41), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Query 55 KYYPDSVVKFHFESSFYTQNTLPCPYHFHYPD 86 KY+ D+V F + Q L P+ F YP+ Sbjct 306 KYFKDTVRWFEIARYLHKQYKL--PFKFTYPE 335 > Alpavirinae_Human_feces_C_016_Microviridae_AG0273_putative.VP4 Length=304 Score = 20.0 bits (40), Expect = 5.2, Method: Compositional matrix adjust. Identities = 20/62 (32%), Positives = 26/62 (42%), Gaps = 5/62 (8%) Query 23 TCNVFTMLLDGTLLPVYDFSGNN-VRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYH 81 TC T+ D L + N VR L+ LRK Y ++ F F TL C H Sbjct 57 TCLFVTLTFDDDNLKKFSKDTNKAVRLFLDRLRKDY-GKQIRHWFVCEF---GTLRCRPH 112 Query 82 FH 83 +H Sbjct 113 YH 114 > Gokush_Human_gut_32_030_Microviridae_AG0185_putative.VP4 Length=310 Score = 20.0 bits (40), Expect = 5.5, Method: Composition-based stats. Identities = 9/51 (18%), Positives = 21/51 (41%), Gaps = 3/51 (6%) Query 33 GTLLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 G +P + + + +RK + + ++F + +Q P H+H Sbjct 81 GEAIPALTLQKRDFQLLMKRIRKKFENDKIRFFMSGEYGSQTFRP---HYH 128 > Gokush_Human_gut_31_045_Microviridae_AG0114_putative.VP4 Length=310 Score = 20.0 bits (40), Expect = 5.5, Method: Composition-based stats. Identities = 9/51 (18%), Positives = 21/51 (41%), Gaps = 3/51 (6%) Query 33 GTLLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 G +P + + + +RK + + ++F + +Q P H+H Sbjct 81 GEAIPALTLQKRDFQLLMKRIRKKFENDKIRFFMSGEYGSQTFRP---HYH 128 > Gokush_Human_gut_27_035_Microviridae_AG0163_putative.VP4 Length=310 Score = 20.0 bits (40), Expect = 5.5, Method: Composition-based stats. Identities = 9/51 (18%), Positives = 21/51 (41%), Gaps = 3/51 (6%) Query 33 GTLLPVYDFSGNNVRSSLNSLRKYYPDSVVKFHFESSFYTQNTLPCPYHFH 83 G +P + + + +RK + + ++F + +Q P H+H Sbjct 81 GEAIPALTLQKRDFQLLMKRIRKKFENDKIRFFMSGEYGSQTFRP---HYH 128 Lambda K H a alpha 0.327 0.140 0.443 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 4169376