bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_4 Length=59 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_A_033_Microviridae_AG0381_putative.VP4 22.3 0.29 Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 19.2 4.1 Alpavirinae_Human_gut_24_085_Microviridae_AG0231_hypothetical.p... 18.9 4.8 Gokush_Human_feces_E_007_Microviridae_AG0415_hypothetical.protein 18.9 5.0 Alpavirinae_Human_feces_D_022_Microviridae_AG0389_putative.VP4 18.5 8.8 Alpavirinae_Human_feces_B_021_Microviridae_AG0368_putative.VP1 18.5 8.9 > Alpavirinae_Human_feces_A_033_Microviridae_AG0381_putative.VP4 Length=307 Score = 22.3 bits (46), Expect = 0.29, Method: Compositional matrix adjust. Identities = 13/47 (28%), Positives = 26/47 (55%), Gaps = 8/47 (17%) Query 12 WRDPKTGQFKTSEYRKKN-----QMSIVDARSYARRLVNIQNVLSVR 53 +RDP TG+F+ YRK + + + D + A+R ++ ++ L + Sbjct 109 YRDPDTGRFR---YRKLSFPYLFVLEVADGKRAAQRKLSSEHRLHIH 152 > Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 Length=536 Score = 19.2 bits (38), Expect = 4.1, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 0/21 (0%) Query 3 KYTFIFEIIWRDPKTGQFKTS 23 KY F+ WR+ TG + S Sbjct 223 KYDTGFDGKWRNTSTGALQPS 243 > Alpavirinae_Human_gut_24_085_Microviridae_AG0231_hypothetical.protein Length=109 Score = 18.9 bits (37), Expect = 4.8, Method: Compositional matrix adjust. Identities = 9/30 (30%), Positives = 14/30 (47%), Gaps = 0/30 (0%) Query 16 KTGQFKTSEYRKKNQMSIVDARSYARRLVN 45 K +KTSEY + + + D S + N Sbjct 72 KISNYKTSEYLRSGNVEVEDKNSGKQEEAN 101 > Gokush_Human_feces_E_007_Microviridae_AG0415_hypothetical.protein Length=60 Score = 18.9 bits (37), Expect = 5.0, Method: Compositional matrix adjust. Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%) Query 14 DPKTGQFKTSEYRKKN 29 +PK + + EY KKN Sbjct 25 EPKQAKQRAEEYAKKN 40 > Alpavirinae_Human_feces_D_022_Microviridae_AG0389_putative.VP4 Length=307 Score = 18.5 bits (36), Expect = 8.8, Method: Compositional matrix adjust. Identities = 12/47 (26%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Query 12 WRDPKTGQFKTSEYRKKN-----QMSIVDARSYARRLVNIQNVLSVR 53 +R+P TG+F YRK + + + D + A+R ++ ++ L + Sbjct 109 YRNPDTGRFC---YRKISFPYFFVLEVADGKRAAQRRLHSEHRLHLH 152 > Alpavirinae_Human_feces_B_021_Microviridae_AG0368_putative.VP1 Length=649 Score = 18.5 bits (36), Expect = 8.9, Method: Composition-based stats. Identities = 11/41 (27%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 12 WRDPKTGQFKTSEYRKKNQMSIVDARSYARRLVNIQNVLSV 52 W D TG + S + +DA + A+++ N+ N ++V Sbjct 370 WIDGVTGINEISAVDVTDGKLTMDALNLAQKVYNMLNRIAV 410 Lambda K H a alpha 0.326 0.136 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3629248