bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=224 Score E Sequences producing significant alignments: (Bits) Value gi|548246698|ref|WP_022464569.1| ribonuclease R 38.5 3.2 gi|488782436|ref|WP_002694843.1| regulator 37.7 7.5 gi|495739192|ref|WP_008463771.1| MULTISPECIES: ATPase 37.0 9.1 >gi|548246698|ref|WP_022464569.1| ribonuclease R [Clostridium sp. CAG:277] gi|524770020|emb|CDE69851.1| ribonuclease R [Clostridium sp. CAG:277] Length=785 Score = 38.5 bits (88), Expect = 3.2, Method: Composition-based stats. Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 9/65 (14%) Query 153 PRSLHSLMESLASLMENFSQSALPGRLSIPAFSDMRAMVDC-----LAMNYIGLYEAYLR 207 P+ + LM ++A E L GRL++ + R DC LAM Y + + +R Sbjct 507 PKEIQKLMRAIAGKPE----EGLIGRLALRSMKQARYTTDCEGHFGLAMKYYCHFTSPIR 562 Query 208 RYPDL 212 RYPDL Sbjct 563 RYPDL 567 >gi|488782436|ref|WP_002694843.1| regulator [Microscilla marina] gi|123991121|gb|EAY30573.1| Two component regulator three Y motif family [Microscilla marina ATCC 23134] Length=1336 Score = 37.7 bits (86), Expect = 7.5, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 0/45 (0%) Query 14 VIFLVRTANYLLNVCVSIYLNLLENMKKYISTLYQNTDPYTSVRI 58 VI LV + NV + +LNLL N+ YI+ QNTD YT + + Sbjct 1017 VIGLVSVQSLQSNVYTNYHLNLLRNLAVYITIALQNTDSYTKIEL 1061 >gi|495739192|ref|WP_008463771.1| MULTISPECIES: ATPase [Flavobacterium] gi|146300805|ref|YP_001195396.1| ATPase central domain-containing protein [Flavobacterium johnsoniae UW101] gi|146155223|gb|ABQ06077.1| AAA ATPase, central domain protein [Flavobacterium johnsoniae UW101] gi|395436248|gb|EJG02183.1| ATPase central domain-containing protein [Flavobacterium sp. F52] Length=363 Score = 37.0 bits (84), Expect = 9.1, Method: Compositional matrix adjust. Identities = 20/69 (29%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Query 36 LENMKKYISTLYQNTDPYTSVRISISYYSRTRTGSPRILAELLIRAGNLVVVIGLPREAT 95 L +K+ I++L QN D ++S I I+ T P +L + + R N V+ +G+P+E Sbjct 198 LGELKRVINSLLQNIDSFSSSNILIA-----ATNHPELLDKAIWRRFNHVIEVGMPKENE 252 Query 96 LNRTLRAML 104 ++ L+ + Sbjct 253 ISELLKEFV 261 Lambda K H a alpha 0.326 0.139 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 869504134146