bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_6 Length=72 Score E Sequences producing significant alignments: (Bits) Value gi|547926030|ref|WP_022328142.1| putative NIF3 family protein 37.7 0.33 gi|407916799|gb|EKG10129.1| Rab GDI protein 35.8 1.8 gi|358384793|gb|EHK22390.1| hypothetical protein TRIVIDRAFT_71413 34.7 4.0 >gi|547926030|ref|WP_022328142.1| putative NIF3 family protein [Prevotella sp. CAG:732] gi|524600825|emb|CDD18374.1| putative NIF3 family protein [Prevotella sp. CAG:732] Length=278 Score = 37.7 bits (86), Expect = 0.33, Method: Composition-based stats. Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 1/26 (4%) Query 11 GDSMVLMMRDRFRVSSVSQCDEYCRR 36 D ++LM+RDRFRV SV QC+E RR Sbjct 166 ADDLILMLRDRFRVESV-QCNELLRR 190 >gi|407916799|gb|EKG10129.1| Rab GDI protein [Macrophomina phaseolina MS6] Length=467 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 18/48 (38%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query 8 DFIGDSMVLMMRDRFRVSSVSQCDEYCRRLEKYLNSLSIYRYKVTQYP 55 DFIG SM L D + +++ Q DE R+ Y+NS++ Y YP Sbjct 192 DFIGHSMALYQTDEY-INNAGQADETIERIRLYVNSMARYGKSPYIYP 238 >gi|358384793|gb|EHK22390.1| hypothetical protein TRIVIDRAFT_71413 [Trichoderma virens Gv29-8] Length=463 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 2/55 (4%) Query 1 LDDLANPDFIGDSMVLMMRDRFRVSSVSQCDEYCRRLEKYLNSLSIYRYKVTQYP 55 L+D A DFIG SM L + D + +++V Q E R+ Y NS++ Y YP Sbjct 186 LED-ATKDFIGHSMALYLTDDY-ITTVGQAPEAIERIRLYGNSVARYGKSPYIYP 238 Lambda K H a alpha 0.325 0.140 0.413 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 431390619156