bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-13_CDS_annotation_glimmer3.pl_2_8 Length=67 Score E Sequences producing significant alignments: (Bits) Value gi|490418707|ref|WP_004291030.1| hypothetical protein 39.3 0.014 gi|496050826|ref|WP_008775333.1| predicted protein 36.2 0.18 >gi|490418707|ref|WP_004291030.1| hypothetical protein [Bacteroides eggerthii] gi|217986634|gb|EEC52968.1| hypothetical protein BACEGG_02719 [Bacteroides eggerthii DSM 20697] Length=64 Score = 39.3 bits (90), Expect = 0.014, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%) Query 32 SCTMSMSIAKNNNNATQQTEQKATSEVKNDSINLKF 67 SCTMSMSI+KNN N+ Q TEQ + V + +++L + Sbjct 28 SCTMSMSISKNNTNSNQSTEQSQATSVDSTTVDLNY 63 >gi|496050826|ref|WP_008775333.1| predicted protein [Bacteroides sp. 2_2_4] gi|229448890|gb|EEO54681.1| hypothetical protein BSCG_01606 [Bacteroides sp. 2_2_4] Length=69 Score = 36.2 bits (82), Expect = 0.18, Method: Compositional matrix adjust. Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 2/34 (6%) Query 34 TMSMSIAKNNNNATQQTEQKATSEVKNDSINLKF 67 TMSMS+ KNN+++TQQ EQK SE +NDS L Sbjct 34 TMSMSVQKNNSSSTQQIEQK--SESRNDSTTLDL 65 Lambda K H a alpha 0.303 0.111 0.293 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438252188976