bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-21_CDS_annotation_glimmer3.pl_2_3 Length=90 Score E Sequences producing significant alignments: (Bits) Value gi|657748481|ref|XP_008309571.1| PREDICTED: COMM domain-containi... 35.4 2.4 gi|492907865|ref|WP_006038271.1| tRNA-dihydrouridine synthase 34.3 7.0 gi|494219311|ref|WP_007133287.1| dihydrouridine synthase DuS 33.5 9.8 >gi|657748481|ref|XP_008309571.1| PREDICTED: COMM domain-containing protein 9 [Cynoglossus semilaevis] Length=195 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 27/59 (46%), Gaps = 3/59 (5%) Query 4 NSWRGLEALITWSDSVTWKTKAGKMPVLVIQYDHFD---DFARWKDWVSHVSFPYAYTR 59 S + L I +S TW+T+A + V + Q H D D R D V H+S P + Sbjct 90 QSLKNLITKILLENSPTWRTEAAGVNVSLPQLTHLDWRVDMVRGSDSVGHMSVPTCLVQ 148 >gi|492907865|ref|WP_006038271.1| tRNA-dihydrouridine synthase [Paenibacillus curdlanolyticus] gi|304345186|gb|EFM11022.1| dihydrouridine synthase DuS [Paenibacillus curdlanolyticus YK9] Length=312 Score = 34.3 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 0/34 (0%) Query 18 SVTWKTKAGKMPVLVIQYDHFDDFARWKDWVSHV 51 ++ TKAG +PV V FD W+DW++H+ Sbjct 114 AIIQATKAGGLPVSVKTRLGFDAIEEWRDWLTHI 147 >gi|494219311|ref|WP_007133287.1| dihydrouridine synthase DuS, partial [Paenibacillus lactis] gi|353179372|gb|EHB44933.1| dihydrouridine synthase DuS, partial [Paenibacillus lactis 154] Length=156 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 0/34 (0%) Query 18 SVTWKTKAGKMPVLVIQYDHFDDFARWKDWVSHV 51 ++ TKAG +PV V FD W+DW++H+ Sbjct 70 AIIQATKAGGLPVSVKTRLGFDAIEEWRDWLTHI 103 Lambda K H a alpha 0.322 0.131 0.462 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438678852570