bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-26_CDS_annotation_glimmer3.pl_2_5 Length=65 Score E Sequences producing significant alignments: (Bits) Value gi|627775614|gb|AHY44837.1| lytic transglycosylase 37.0 0.52 gi|518237199|ref|WP_019407407.1| lytic transglycosylase 36.6 0.81 gi|495842956|ref|WP_008567535.1| lytic transglycosylase 36.2 0.94 gi|505091675|ref|WP_015278777.1| lytic murein transglycosylase 36.2 0.96 gi|567901214|ref|XP_006443095.1| hypothetical protein CICLE_v100... 34.3 3.8 gi|657347853|ref|WP_029404680.1| lytic transglycosylase 34.3 4.1 gi|533220375|gb|EQM75374.1| lytic transglycosylase 34.3 5.0 gi|665945099|ref|WP_031311144.1| lytic transglycosylase 33.9 5.1 gi|567901212|ref|XP_006443094.1| hypothetical protein CICLE_v100... 33.9 6.5 >gi|627775614|gb|AHY44837.1| lytic transglycosylase [Pseudomonas stutzeri] Length=373 Score = 37.0 bits (84), Expect = 0.52, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV SAG LD MR Y +++ E Sbjct 26 QQLEMVSEQFEAMFLQQILK--QMRKAGDVLSAGNPMRSRELDTMRDFYDEVLAE 78 >gi|518237199|ref|WP_019407407.1| lytic transglycosylase [Pseudomonas stutzeri] Length=370 Score = 36.6 bits (83), Expect = 0.81, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV SAG LD MR Y +++ E Sbjct 26 QQLEMVSEQFEAMFLQQILK--QMRKAGDVLSAGNPMRSRELDTMRDFYDEVLAE 78 >gi|495842956|ref|WP_008567535.1| lytic transglycosylase [Pseudomonas sp. Chol1] gi|409121014|gb|EKM97201.1| lytic transglycosylase, catalytic [Pseudomonas sp. Chol1] Length=376 Score = 36.2 bits (82), Expect = 0.94, Method: Composition-based stats. Identities = 17/55 (31%), Positives = 32/55 (58%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV +AG LD MR Y +++ E Sbjct 26 QQLEVVSEQFEAMFLQQILK--QMRKAGDVLAAGNPMRSRELDTMRDFYDEVLAE 78 >gi|505091675|ref|WP_015278777.1| lytic murein transglycosylase [Pseudomonas stutzeri] gi|431929211|ref|YP_007242245.1| lytic murein transglycosylase [Pseudomonas stutzeri RCH2] gi|431827498|gb|AGA88615.1| soluble lytic murein transglycosylase-like protein [Pseudomonas stutzeri RCH2] Length=370 Score = 36.2 bits (82), Expect = 0.96, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV SAG LD MR Y +++ E Sbjct 26 QQLEMVSEQFEAMFLQQILK--QMRKAGDVLSAGNPMRSRELDTMRDFYDEVLAE 78 >gi|567901214|ref|XP_006443095.1| hypothetical protein CICLE_v10024062mg, partial [Citrus clementina] gi|557545357|gb|ESR56335.1| hypothetical protein CICLE_v10024062mg, partial [Citrus clementina] Length=303 Score = 34.3 bits (77), Expect = 3.8, Method: Composition-based stats. Identities = 19/58 (33%), Positives = 33/58 (57%), Gaps = 3/58 (5%) Query 2 DISQTMEIIDQVYQDMFVETVLKFEVLEK--SVDVGSAGRMAHQERLDGMRKLYTKLI 57 + +QT+E + + +DM +E +LEK ++++ AG AH LD R+ Y K+I Sbjct 89 NFNQTLEYVKDI-RDMRMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSREYYPKII 145 >gi|657347853|ref|WP_029404680.1| lytic transglycosylase [Pseudomonas stutzeri] Length=343 Score = 34.3 bits (77), Expect = 4.1, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV AG LD MR Y +++ + Sbjct 26 QQLEVVAEQFEAMFLQQILK--QMRKAGDVLGAGNPMRSRELDTMRDFYDEVLAD 78 >gi|533220375|gb|EQM75374.1| lytic transglycosylase [Pseudomonas stutzeri MF28] Length=350 Score = 34.3 bits (77), Expect = 5.0, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV AG LD MR Y +++ + Sbjct 34 QQLEVVAEQFEAMFLQQILK--QMRKAGDVLGAGNPMRSRELDTMRDFYDEVLAD 86 >gi|665945099|ref|WP_031311144.1| lytic transglycosylase [Pseudomonas stutzeri] Length=342 Score = 33.9 bits (76), Expect = 5.1, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (4%) Query 5 QTMEIIDQVYQDMFVETVLKFEVLEKSVDVGSAGRMAHQERLDGMRKLYTKLIKE 59 Q +E++ + ++ MF++ +LK + K+ DV AG LD MR Y +++ + Sbjct 26 QQLEVVAEQFEAMFLQQILK--QMRKAGDVLGAGNPMRSRELDTMRDFYDEVLAD 78 >gi|567901212|ref|XP_006443094.1| hypothetical protein CICLE_v10024495mg [Citrus clementina] gi|557545356|gb|ESR56334.1| hypothetical protein CICLE_v10024495mg [Citrus clementina] Length=372 Score = 33.9 bits (76), Expect = 6.5, Method: Composition-based stats. Identities = 19/58 (33%), Positives = 33/58 (57%), Gaps = 3/58 (5%) Query 2 DISQTMEIIDQVYQDMFVETVLKFEVLEK--SVDVGSAGRMAHQERLDGMRKLYTKLI 57 + +QT+E + + +DM +E +LEK ++++ AG AH LD R+ Y K+I Sbjct 143 NFNQTLEYVKDI-RDMGMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSREYYPKII 199 Lambda K H a alpha 0.321 0.136 0.362 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 440996816904