bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-31_CDS_annotation_glimmer3.pl_2_2 Length=160 Score E Sequences producing significant alignments: (Bits) Value gi|490418710|ref|WP_004291033.1| hypothetical protein 42.7 0.018 gi|147823286|emb|CAN75274.1| hypothetical protein VITISV_043735 38.9 0.98 gi|547226429|ref|WP_021963492.1| putative uncharacterized protein 36.6 2.9 >gi|490418710|ref|WP_004291033.1| hypothetical protein [Bacteroides eggerthii] gi|217986637|gb|EEC52971.1| hypothetical protein BACEGG_02722 [Bacteroides eggerthii DSM 20697] Length=155 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 3/112 (3%) Query 2 FSAKCFNPAVVEGEITLEVDNVDLFRIEQVEHTDPLESYIRVRSDISMLFHAEATAKKIG 61 F N AV+ G +E + F +++E D +S IR+ SDI MLF+ + K Sbjct 15 FQPNNVNSAVLSGSEFVEPSPLHEFMFQEIE-CDGKKS-IRITSDIYMLFNQQRLDKLTR 72 Query 62 TEGFRFLAESRRVKSSPTQAMMDKMPDDLILDTLKSRHLQQPSELLAFSEQL 113 ++ + ++ V + KM D+ + +KSR +Q PSEL+A+S+ L Sbjct 73 SQLVEYF-DNLSVSEPKMSDLRKKMTDEQLCSFVKSRFIQTPSELMAWSQYL 123 >gi|147823286|emb|CAN75274.1| hypothetical protein VITISV_043735 [Vitis vinifera] Length=656 Score = 38.9 bits (89), Expect = 0.98, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 31/60 (52%), Gaps = 3/60 (5%) Query 76 SSPTQAMMDKMPD---DLILDTLKSRHLQQPSELLAFSEQLSALASDMEEEYEAYFKSQT 132 SSP QAM+ K PD DT + HL ++ L+ + S M+ EY+A +++T Sbjct 218 SSPLQAMLAKTPDHQDSWFFDTGATHHLSHSAQTLSHVQPYSGADQAMQHEYQALLRNRT 277 >gi|547226429|ref|WP_021963492.1| putative uncharacterized protein [Prevotella sp. CAG:1185] gi|524103381|emb|CCY83992.1| putative uncharacterized protein [Prevotella sp. CAG:1185] Length=152 Score = 36.6 bits (83), Expect = 2.9, Method: Compositional matrix adjust. Identities = 21/70 (30%), Positives = 39/70 (56%), Gaps = 1/70 (1%) Query 46 DISMLFHAEATAKKIGTEGFRFLAESRRVKSSPTQAMMDKMPDDLILDTLKSRHLQQPSE 105 DI MLF+ + +G + + + +S + + + D+ +++ KSR++Q SE Sbjct 55 DIYMLFN-QNRLDSVGRDTIQKWLDGLTPRSDSLAKLRENVTDEQLMEICKSRYIQSSSE 113 Query 106 LLAFSEQLSA 115 LLA+SE L+A Sbjct 114 LLAWSEYLNA 123 Lambda K H a alpha 0.314 0.129 0.344 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 440189462094