bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-36_CDS_annotation_glimmer3.pl_2_4 Length=92 Score E Sequences producing significant alignments: (Bits) Value gi|310722487|ref|YP_003969310.1| unnamed protein product 35.8 0.68 gi|262263169|dbj|BAI48087.1| kinetochore protein 33.9 9.5 >gi|310722487|ref|YP_003969310.1| unnamed protein product [Aeromonas phage phiAS5] gi|306021330|gb|ADM79864.1| hypothetical protein phiAS5_ORF0021 [Aeromonas phage phiAS5] Length=112 Score = 35.8 bits (81), Expect = 0.68, Method: Compositional matrix adjust. Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%) Query 34 KSAISRAKETVANTDVAPAE-YQCVKKRKLENGYFYASVR 72 S+I KE +AN D PAE ++C K+ ++ENG+ Y V+ Sbjct 38 NSSIIGVKEIMANPDRTPAESHECWKRVQIENGWKYGEVK 77 >gi|262263169|dbj|BAI48087.1| kinetochore protein [Nicotiana sylvestris] Length=246 Score = 33.9 bits (76), Expect = 9.5, Method: Compositional matrix adjust. Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 7/81 (9%) Query 8 TKAMKVYQVLKVTKEGQYLVKTCPMLKSAISRAKETVANTDVAPAEYQCVKKRKLENGYF 67 T+A+++YQ L V ++ + LV+T ++ + E +A V +E++ K+ + NG Sbjct 162 TEALELYQQLAVDEKFEELVRTASGFQTKV----ENLATRMVENSEHRRAKRIRTSNGEM 217 Query 68 YASVRLMHDGYAIDAEIWKTQ 88 + RL +DG + A + + Q Sbjct 218 F---RLSNDGGLLSATLEELQ 235 Lambda K H a alpha 0.317 0.129 0.370 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 435738179790