bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-4_CDS_annotation_glimmer3.pl_2_9 Length=196 Score E Sequences producing significant alignments: (Bits) Value gi|360043474|emb|CCD78887.1| putative cln3/battenin 39.3 0.21 gi|629647156|ref|XP_007801519.1| hypothetical protein EPUS_04232 36.6 9.4 >gi|360043474|emb|CCD78887.1| putative cln3/battenin [Schistosoma mansoni] Length=92 Score = 39.3 bits (90), Expect = 0.21, Method: Compositional matrix adjust. Identities = 21/62 (34%), Positives = 33/62 (53%), Gaps = 9/62 (15%) Query 135 DYSPDLPTM-MVLFYEGLLKYMKLCNAYYDSLPETSPLRKQLREMYPNLYVGGVSTISDE 193 Y P + M MV+FYEG L + N +Y+ L ETSP+ ++ Y ++T+SD Sbjct 19 SYIPHIWIMFMVIFYEGCLGGLTYVNTFYNILQETSPIYRE--------YAMAMATVSDS 70 Query 194 VA 195 + Sbjct 71 IG 72 >gi|629647156|ref|XP_007801519.1| hypothetical protein EPUS_04232 [Endocarpon pusillum Z07020] gi|539436725|gb|ERF72797.1| hypothetical protein EPUS_04232 [Endocarpon pusillum Z07020] Length=602 Score = 36.6 bits (83), Expect = 9.4, Method: Composition-based stats. Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 0/35 (0%) Query 129 PGRISIDYSPDLPTMMVLFYEGLLKYMKLCNAYYD 163 P R+SI+ SPD + + F EGL++ +L AYYD Sbjct 207 PCRVSIEPSPDGAGLRICFQEGLIESRRLGGAYYD 241 Lambda K H a alpha 0.328 0.143 0.418 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 599296957224