bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_2 Length=65 Score E Sequences producing significant alignments: (Bits) Value gi|496050826|ref|WP_008775333.1| predicted protein 37.7 0.056 gi|330930892|ref|XP_003303187.1| hypothetical protein PTT_15305 35.0 2.3 gi|654351803|ref|WP_027844945.1| stem cell self-renewal protein ... 33.5 9.9 >gi|496050826|ref|WP_008775333.1| predicted protein [Bacteroides sp. 2_2_4] gi|229448890|gb|EEO54681.1| hypothetical protein BSCG_01606 [Bacteroides sp. 2_2_4] Length=69 Score = 37.7 bits (86), Expect = 0.056, Method: Compositional matrix adjust. Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 4/69 (6%) Query 1 MKITPNQWIELVKLISTFIIGVITALTVQSC--TASMSVFWKNQNSKQDSQQTTQQEVDS 58 MK+T +QW +++ I T ++ + + V SC T SMSV N +S Q +Q ++ DS Sbjct 1 MKLTSDQWNRIIQAIVTAVVTICNIILVSSCAVTMSMSVQKNNSSSTQQIEQKSESRNDS 60 Query 59 VTIK--PQF 65 T+ P F Sbjct 61 TTLDLSPNF 69 >gi|330930892|ref|XP_003303187.1| hypothetical protein PTT_15305 [Pyrenophora teres f. teres 0-1] gi|311320953|gb|EFQ88712.1| hypothetical protein PTT_15305 [Pyrenophora teres f. teres 0-1] Length=380 Score = 35.0 bits (79), Expect = 2.3, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 3/61 (5%) Query 8 WIELVKLISTFIIGVITALTVQSCTASMSVFWKNQNSKQDSQQT---TQQEVDSVTIKPQ 64 WIE KL TFI+ + + V + TASM ++ + + +Q +Q ++Q+ + + +K Q Sbjct 6 WIEEEKLKKTFIVATLASTLVGTFTASMGLWERVADRRQQHRQKAKDSKQDGEIIELKKQ 65 Query 65 F 65 F Sbjct 66 F 66 >gi|654351803|ref|WP_027844945.1| stem cell self-renewal protein Piwi [Mastigocoleus testarum] Length=764 Score = 33.5 bits (75), Expect = 9.9, Method: Composition-based stats. Identities = 17/46 (37%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Query 6 NQWIELVKLISTFIIGV-ITALTVQSCTASMSVFWKNQNSKQDSQQ 50 N W E+++L FI + ITA + +CT +++ F++N + KQ+ QQ Sbjct 169 NFWAEIIELEGQFIPALTITAKSNFNCTINLAEFYQNHSYKQNPQQ 214 Lambda K H a alpha 0.316 0.124 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 440996816904