bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-15_CDS_annotation_glimmer3.pl_2_6 Length=211 Score E Sequences producing significant alignments: (Bits) Value 7260.FBpp0245763 37.0 3.0 > 7260.FBpp0245763 Length=1645 Score = 37.0 bits (84), Expect = 3.0, Method: Composition-based stats. Identities = 39/139 (28%), Positives = 59/139 (42%), Gaps = 9/139 (6%) Query 50 RAQRSGMLLDNEAKGILNKYLDQEQQLDLNVKAADYYQRMSAGYLSYAETKKALADEALA 109 + ++ + L AK K +Q D +K A+ AG+ S E K AD+AL Sbjct 1366 KQKQDDIELLERAKAAFEKATKAVKQGDNTLKEANNTYNTLAGFQSDVEASKEKADQALQ 1425 Query 110 AARTRGQKISN--EVASRIAESQIAANIAANQSSEAYHNEELKLGLSQDNARSKNIEEWY 167 + Q+I N + S+ E+ AN AN++ E + K SK+ E Sbjct 1426 TVPSIEQEIQNAKHLISQADEALDGANKNANEAKENAQEAQKKYA----EQASKDAELIR 1481 Query 168 RSRNEKK---RYKYYDADK 183 R NE K R Y+AD+ Sbjct 1482 RKANETKVAARNLRYEADQ 1500 Lambda K H a alpha 0.312 0.127 0.350 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 244463840400