bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-19_CDS_annotation_glimmer3.pl_2_5 Length=147 Score E Sequences producing significant alignments: (Bits) Value 483218.BACPEC_03011 35.4 3.1 > 483218.BACPEC_03011 Length=415 Score = 35.4 bits (80), Expect = 3.1, Method: Compositional matrix adjust. Identities = 20/67 (30%), Positives = 32/67 (48%), Gaps = 12/67 (18%) Query 23 YRNLVNNWITAPVGSVAFTGQLRYAVRSIHSFYDYCAKRSLRDQLLKVEKWSNDSYVREN 82 +R LVN + G L A I++ DYC + L+D++ E + ND Y+ Sbjct 145 FRELVNAGV----------GDLAIAQAGIYAVDDYCGRYGLKDEIAAAELYLNDKYLSHA 194 Query 83 L--SIYY 87 L S+Y+ Sbjct 195 LDRSVYF 201 Lambda K H a alpha 0.322 0.135 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128622692630