bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_3 Length=307 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0207 43.9 0.033 > 5833.PF10_0207 Length=454 Score = 43.9 bits (102), Expect = 0.033, Method: Compositional matrix adjust. Identities = 37/139 (27%), Positives = 65/139 (47%), Gaps = 9/139 (6%) Query 53 WFVRAHNIYKRLGYNLSNSYFCTFTL---KPEFYEAFCKEPYAFIRRFIDRMRKDQFLRY 109 +F ++ NI K + YN N F FT+ K ++ F K+ YAFI F ++ D+ ++ Sbjct 181 FFNKSSNISKLISYNSVNFLFLLFTILYFKSDYIYTFFKKKYAFIGEF-KNIKTDKLVKI 239 Query 110 RNPDTGRFCYRKISFPYLFVLEVADGKRAAQRRLHSEHRLHLHAIMFG--CPLPWWRVRH 167 T F + K F L +L + + ++L+ + L +H + F P++ V+ Sbjct 240 HTLSTLLFFFYK--FFVLRLLFILNSYNFFSQKLYLINNL-IHILFFSYISIFPYFLVQA 296 Query 168 YWMSFGLAWVSPLRHFGGV 186 W SF L + GG+ Sbjct 297 NWGSFHLLGYKKSKILGGL 315 Lambda K H a alpha 0.328 0.141 0.480 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 511542968160