bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-25_CDS_annotation_glimmer3.pl_2_6 Length=163 Score E Sequences producing significant alignments: (Bits) Value 1116375.VEJY3_23341 38.1 0.52 > 1116375.VEJY3_23341 Length=547 Score = 38.1 bits (87), Expect = 0.52, Method: Compositional matrix adjust. Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 4/71 (6%) Query 80 YGDFTGLPSDPIEALNLVHQSEYAFAQLSADDKAKYNNDWRRWFADLLSGRDNLSEKLSS 139 Y DFT L P+ L H S+Y A+ + + +A N +R ++++ DNLSEKL+ Sbjct 122 YVDFTRLTMTPL--LTQKHASQYTTAEFNQNFEAAMVN-YRVAGEEMINAIDNLSEKLNQ 178 Query 140 VVPNSDVEKEG 150 V SDV+ G Sbjct 179 TVI-SDVQANG 188 Lambda K H a alpha 0.311 0.130 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127453231230