bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-31_CDS_annotation_glimmer3.pl_2_3 Length=365 Score E Sequences producing significant alignments: (Bits) Value 484018.BACPLE_00802 78.6 1e-13 > 484018.BACPLE_00802 Length=344 Score = 78.6 bits (192), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 22/152 (14%) Query 38 KSANAMNYKINQMNNEFNAAEAQKSRDYMTDMWNKTNEYNSPSAMRQRLVEAGYNPYLGL 97 +S N N +I QM+NE+N + ++ + DMWN NEYNS S+ R+RL EAG NPY+ + Sbjct 41 ESTNQANIQIAQMSNEYNREQLERQIEQEWDMWNAENEYNSASSQRKRLEEAGLNPYMMM 100 Query 98 NSGAAGSASNVGSPATGSAAA----AAPQQSYDWSNLA--SSVSSAF------------- 138 + G+AGSAS++ SPA A A Q D S L+ ++S F Sbjct 101 DGGSAGSASSMTSPAAQPAVVPQMQGATMQPADMSGLSGLRGIASEFIATLKAQEDIRGQ 160 Query 139 QIANQTQQTNASVSALQGQKSLADAETYQTLS 170 Q+ N+ Q+ A K LAD E +T S Sbjct 161 QLINEGQEIENQYKA---DKLLADLEKTRTES 189 Lambda K H a alpha 0.310 0.122 0.344 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 675393053440