bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-31_CDS_annotation_glimmer3.pl_2_5 Length=166 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01608 56.6 4e-07 > 469590.BSCG_01608 Length=497 Score = 56.6 bits (135), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 3/73 (4%) Query 15 ECLRPRRVTNPYTADVLFSPCGCCAACVANKANVATAYVQNMASY-FKFCYFVTLTYADT 73 +CL P+R+ NPYT + + PCG C AC K N A+ ++ SY K F+TLTYA+ Sbjct 8 KCLHPKRIMNPYTKESMVVPCGHCQACTLAK-NSRYAFQCDLESYTAKHTLFITLTYANR 66 Query 74 FLP-MVDVCAVER 85 F+P + V ++ER Sbjct 67 FIPRAMFVDSIER 79 Lambda K H a alpha 0.324 0.137 0.429 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125712794220