bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-3_CDS_annotation_glimmer3.pl_2_7 Length=168 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01610 61.2 1e-09 > 469590.BSCG_01610 Length=154 Score = 61.2 bits (147), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 39/121 (32%), Positives = 66/121 (55%), Gaps = 11/121 (9%) Query 19 CTPIREVQICPICASSEPDI--VLEELPTEPFRFEKVGTEENEAVRVRSDVSMLLHAADM 76 TP+RE I S E EE P + F F++V + + ++R+ SD+ ML + + Sbjct 11 VTPVRE----NIVGSKEMQCSEFREESPVDQFLFQEVSVDGDTSIRLSSDIYMLFNQQRL 66 Query 77 AKKYGTGFVKSM--IEMHRPKSSGLQSEMDLMSDAQILDTIKSRHLQSPSELIAWSEYLI 134 K T ++ I + P+ + L+S++ D Q++ +KSR +QS SEL+AWS YL+ Sbjct 67 DKLSQTSLLEYFNNISVTEPRFNELRSKL---GDEQLISFVKSRFIQSKSELMAWSNYLM 123 Query 135 D 135 + Sbjct 124 N 124 Lambda K H a alpha 0.312 0.127 0.359 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128341178000