bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-4_CDS_annotation_glimmer3.pl_2_8 Length=104 Score E Sequences producing significant alignments: (Bits) Value 766149.SFK304_2609 37.7 0.17 > 766149.SFK304_2609 Length=245 Score = 37.7 bits (86), Expect = 0.17, Method: Compositional matrix adjust. Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 6/66 (9%) Query 32 LRSIPRVSKLQNFKDE--YFEELVWMLPEIAESLKKKN-NTDASGAFPQFKGLLKYVNIR 88 LRS+PR L + DE + MLPE+ +LK+ N +++ S A P+ L+Y+N+ Sbjct 71 LRSLPR---LPDNLDEINVSNNQLSMLPELPRALKELNASSNQSSALPELPVSLEYINVS 127 Query 89 DYQLFA 94 D LFA Sbjct 128 DNHLFA 133 Lambda K H a alpha 0.325 0.140 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 124827191600