bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_1 Length=107 Score E Sequences producing significant alignments: (Bits) Value mar:MAE_45000 hypothetical protein 37.4 0.034 sua:Saut_1235 hypothetical protein 34.3 0.64 csv:101212813 uncharacterized LOC101212813 34.3 2.9 api:100169425 CD109 antigen 33.9 4.8 lbc:LACBIDRAFT_333126 hypothetical protein 33.1 6.9 efm:M7W_2639 PTS system, N-acetylglucosamine-specific IIA, IIB... 32.7 9.9 efu:HMPREF0351_12626 nagE2; PTS system N-acetylglucosamine tra... 32.7 9.9 efc:EFAU004_02677 PTS system, N-acetylglucosamine-specific IIC... 32.7 9.9 > mar:MAE_45000 hypothetical protein Length=55 Score = 37.4 bits (85), Expect = 0.034, Method: Compositional matrix adjust. Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Query 20 EGETIEEKVNRVVNNNEPITDGAPIIFTEKKDGVLPEYNPRTDRWDIAL 68 GE + +K R +NN IT G IIF EK +PE++PR+ +W + L Sbjct 7 SGEALMQKAKRRINNQFLIT-GFSIIFREK----VPEFSPRSLQWPVLL 50 > sua:Saut_1235 hypothetical protein Length=66 Score = 34.3 bits (77), Expect = 0.64, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 8 SFFNRMKPCECFEGETIEEKVNRVVNNNEPITDGAPIIFTEKKDGVLP 55 + FN KPC C TI+ K+ ++N+ P + F ++ GV P Sbjct 13 ALFNSSKPCHCHLFFTIKSKLMVLLNHYIPRCPFYTVCFAFRRSGVHP 60 > csv:101212813 uncharacterized LOC101212813 Length=767 Score = 34.3 bits (77), Expect = 2.9, Method: Composition-based stats. Identities = 25/94 (27%), Positives = 50/94 (53%), Gaps = 14/94 (15%) Query 2 KTRIVPSFFNRMKPCECFEGETIEEKVNRVVNNNEPITDGAPIIFTEKKD------GVLP 55 + + VPS+ K C F E+ + + +R+ ++ P ++GAP++ T++K G LP Sbjct 438 RVKTVPSYH---KLCFIFGEESSDRRYSRLAHDTHP-SNGAPVLMTDEKKNNEVSAGPLP 493 Query 56 --EYNPRTDR--WDIALTAMEKMDRARKAKKEQG 85 ++ P+ DR D+ L +++ + +A EQ Sbjct 494 MIDWTPQMDRSFIDLMLEQLQEGNTFGQAFSEQA 527 > api:100169425 CD109 antigen Length=1635 Score = 33.9 bits (76), Expect = 4.8, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 9/65 (14%) Query 5 IVPSFFNRMKPCECFEGETIEEKVNRVVNNNEPITDGAPIIFTE--------KKDGVLPE 56 ++P F N P C EGE I +V V NN + I+ ++DG++ Sbjct 862 VLPFFMNVEMPTHCKEGEQIGIRVT-VFNNQCNSVEAVVILLGSESYKFVHVEEDGIVNS 920 Query 57 YNPRT 61 YNPRT Sbjct 921 YNPRT 925 > lbc:LACBIDRAFT_333126 hypothetical protein Length=285 Score = 33.1 bits (74), Expect = 6.9, Method: Compositional matrix adjust. Identities = 20/75 (27%), Positives = 37/75 (49%), Gaps = 8/75 (11%) Query 14 KPCECFEGETIEEKVNRVVNNNEPITDGAPIIFTEKKDGVLPEYNPRTDRWDIALTAMEK 73 KPC+ I+ K+ ++ N+ + G+ ++ G+LPE + T RW+I L Sbjct 111 KPCDALR--KIQAKLFQIKNHEIVLLKGSDLM-----SGILPEQDSDTSRWNIPLCGSRT 163 Query 74 M-DRARKAKKEQGVK 87 M +R R++ V+ Sbjct 164 MKNRGRRSISSHIVR 178 > efm:M7W_2639 PTS system, N-acetylglucosamine-specific IIA, IIB, IIC component Length=652 Score = 32.7 bits (73), Expect = 9.9, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 29/55 (53%), Gaps = 5/55 (9%) Query 7 PSFFNRMKPCECFEGETIEEKVNRVVNNNE-PITDGAPIIFTEKKDG----VLPE 56 P+ N + E F GETIE+ + + N PIT+ + +F EK G VLPE Sbjct 483 PAQTNTVVKTETFAGETIEQDIYAIANGKLIPITEVSDDVFAEKMMGDGYAVLPE 537 > efu:HMPREF0351_12626 nagE2; PTS system N-acetylglucosamine transporter subunit IIABC (EC:2.7.1.69) Length=652 Score = 32.7 bits (73), Expect = 9.9, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 29/55 (53%), Gaps = 5/55 (9%) Query 7 PSFFNRMKPCECFEGETIEEKVNRVVNNNE-PITDGAPIIFTEKKDG----VLPE 56 P+ N + E F GETIE+ + + N PIT+ + +F EK G VLPE Sbjct 483 PAQTNTVVKTETFAGETIEQDIYAIANGKLIPITEVSDDVFAEKMMGDGYAVLPE 537 > efc:EFAU004_02677 PTS system, N-acetylglucosamine-specific IICBA component (EC:2.7.1.69) Length=652 Score = 32.7 bits (73), Expect = 9.9, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 29/55 (53%), Gaps = 5/55 (9%) Query 7 PSFFNRMKPCECFEGETIEEKVNRVVNNNE-PITDGAPIIFTEKKDG----VLPE 56 P+ N + E F GETIE+ + + N PIT+ + +F EK G VLPE Sbjct 483 PAQTNTVVKTETFAGETIEQDIYAIANGKLIPITEVSDDVFAEKMMGDGYAVLPE 537 Lambda K H a alpha 0.313 0.134 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125230604613