bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-2_CDS_annotation_glimmer3.pl_2_3 Length=73 Score E Sequences producing significant alignments: (Bits) Value gi|496050826|ref|WP_008775333.1| predicted protein 33.1 2.5 >gi|496050826|ref|WP_008775333.1| predicted protein [Bacteroides sp. 2_2_4] gi|229448890|gb|EEO54681.1| hypothetical protein BSCG_01606 [Bacteroides sp. 2_2_4] Length=69 Score = 33.1 bits (74), Expect = 2.5, Method: Compositional matrix adjust. Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 2/69 (3%) Query 7 MKITATQWIEIVKLIATFVIGVITTLFVHSC--TLSLSVAknntnstqkteqtstssVDS 64 MK+T+ QW I++ I T V+ + + V SC T+S+SV KNN++STQ+ EQ S S DS Sbjct 1 MKLTSDQWNRIIQAIVTAVVTICNIILVSSCAVTMSMSVQKNNSSSTQQIEQKSESRNDS 60 Query 65 TRININSKY 73 T ++++ + Sbjct 61 TTLDLSPNF 69 Lambda K H a alpha 0.325 0.131 0.364 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 430018305192