bitscore colors: <40, 40-50 , 50-80, 80-200, >200

           BLASTP 2.2.30+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           49,011,213 sequences; 17,563,301,199 total letters





Query= Contig-36_CDS_annotation_glimmer3.pl_2_2

Length=71
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gi|488933737|ref|WP_002844812.1|  acetolactate synthase               33.9    7.1


>gi|488933737|ref|WP_002844812.1| acetolactate synthase [Campylobacter coli]
 gi|543940588|ref|YP_008533354.1| acetolactate synthase large subunit [Campylobacter coli CVM N29710]
 gi|556578997|ref|YP_008747008.1| Acetolactate synthase large subunit [Campylobacter coli 15-537360]
 gi|380558726|gb|EIA81901.1| acetolactate synthase, large subunit [Campylobacter coli 59-2]
 gi|380590471|gb|EIB11481.1| acetolactate synthase, large subunit [Campylobacter coli H9]
 gi|540155536|gb|ERG00554.1| acetolactate synthase large subunit [Campylobacter coli CVM N29716]
 gi|540365903|gb|AGV09760.1| acetolactate synthase large subunit [Campylobacter coli CVM N29710]
 gi|556030435|gb|AGZ21516.1| Acetolactate synthase large subunit [Campylobacter coli 15-537360]
Length=585

 Score = 33.9 bits (76),  Expect = 7.1, Method: Composition-based stats.
 Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%)

Query  7    IDISNQHAKFNFDQAKNWDSTERFTNVATTWINSISCAVGQFTGSASDLKQA  58
            I ++ Q ++F+FDQAK++  T+ + N+   +I S + ++ Q    AS + +A
Sbjct  164  IPMNIQRSEFDFDQAKSFFKTKEYLNMQNYYITSNNLSIKQIKHIASKISKA  215



Lambda      K        H        a         alpha
   0.317    0.129    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 432762933120