bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-4_CDS_annotation_glimmer3.pl_2_8 Length=138 Score E Sequences producing significant alignments: (Bits) Value gi|671244107|gb|KFF29024.1| cold-shock protein 33.9 5.0 gi|659649627|emb|CDR76316.1| Conserved hypothetical protein (fra... 33.5 10.0 >gi|671244107|gb|KFF29024.1| cold-shock protein [Chryseobacterium piperi] Length=64 Score = 33.9 bits (76), Expect = 5.0, Method: Compositional matrix adjust. Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 2/59 (3%) Query 48 DGYIKALNAEYSASYDINSPFKYGEDSYVPASVLKSRMDALNSKWQFDKRYWTEGLNAL 106 +G +K N + + SP GED +V AS L +R+ N K F+ + +GLNA+ Sbjct 3 EGTVKFFNE--TKGFGFISPSNGGEDIFVHASGLSTRIIRENDKVTFEVQKGEKGLNAI 59 >gi|659649627|emb|CDR76316.1| Conserved hypothetical protein (fragment) [Lactobacillus delbrueckii subsp. bulgaricus] Length=78 Score = 33.5 bits (75), Expect = 10.0, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 2/67 (3%) Query 29 MMAEAKGL-QINNKAAEDTADGYIKALNAEYSASYDINSPFKYGEDSYVPASVLKSRMDA 87 + + GL + NNK + D + AL +E + S+ + F++G D ++ A L R+D Sbjct 11 VFCDVNGLHETNNKFGHEAGDRMLIALASELAKSFGQDMSFRFGGDDFL-AIALDERLDK 69 Query 88 LNSKWQF 94 + +K F Sbjct 70 VQAKRYF 76 Lambda K H a alpha 0.313 0.128 0.369 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438030119100