bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-29_CDS_annotation_glimmer3.pl_2_5 Length=179 Score E Sequences producing significant alignments: (Bits) Value 645462.CD196_2603 42.4 0.019 > 645462.CD196_2603 Length=214 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 31/104 (30%), Positives = 44/104 (42%), Gaps = 5/104 (5%) Query 4 SILSARRIKMPKFANQFEPHA-RIHTNPGTPEKVL---YGPVFDENGTLDLEPKGKENLY 59 ++L K P F + P+ RI G + L YG +D N +E K N+ Sbjct 88 ALLVVGNTKSPMFPEELLPYTNRIKAKEGQIKANLLVNYGWYWDLNNISGVENVNKNNIQ 147 Query 60 DYIQSHKDSCDIKLIVDRCARGDLSALSKAQGMYGDFTTLPRTY 103 DYIQS D + LI+ R LS Q +Y DF + + Sbjct 148 DYIQSF-DVSRLDLIIRWGGRRRLSGFLPVQSIYADFYVIDNYW 190 Lambda K H a alpha 0.317 0.134 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 155760141110