bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-17_CDS_annotation_glimmer3.pl_2_1 Length=360 Score E Sequences producing significant alignments: (Bits) Value pbi:103048473 NUSAP1; nucleolar and spindle associated protein 1 37.0 pmb:A9601_09741 class-V aminotransferase family cysteine desul... 37.0 6.5 > pbi:103048473 NUSAP1; nucleolar and spindle associated protein 1 Length=467 Score = 37.0 bits (84), Expect = 5.9, Method: Compositional matrix adjust. Identities = 23/85 (27%), Positives = 44/85 (52%), Gaps = 6/85 (7%) Query 236 LDGIGYQDSLNGERAWWTDYLTADPDLKRTSAG---KTVAWINYMTNVNRTFGNFAPGMS 292 ++ + DSL+G++ +T +A PD K+ K ++ +Y+ N+ NF+ ++ Sbjct 166 VESKTFLDSLSGKKTTYTGSRSATPDFKKLHEAQFKKMLSIDDYIERKNKMMRNFSSSVN 225 Query 293 ESFMVLNRNYSMNNSASPQIEDLTT 317 E M+ +N S+ S Q E+L T Sbjct 226 EIKMLAKKNKSLKTS---QKENLNT 247 > pmb:A9601_09741 class-V aminotransferase family cysteine desulfurase (EC:2.8.1.7) Length=390 Score = 37.0 bits (84), Expect = 6.5, Method: Compositional matrix adjust. Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 4/86 (5%) Query 17 LDTIRDKILLT----PGDTVFDIGSKISSVAPFNTLTERFNNNKLKTSAPQFGLCLKTYN 72 L+ IR KI P D +F GS S+ FN + E+F N ++ S + + N Sbjct 49 LEKIRSKIAYIFEADPEDIIFTSGSSESTNIVFNNIYEKFKNGRVVISNVEHQATIICAN 108 Query 73 SDLYQNWINTEWIEGVDGINEASAVD 98 QNW EW DGI S ++ Sbjct 109 KLRKQNWDIFEWTVKNDGILNISNIE 134 Lambda K H a alpha 0.317 0.133 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 681980606862